DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sun-2012-8 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. DIP original experiment: DIP-253549X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages. Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. Only protein-protein interactions imex curation sun-2012-9 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. DIP original experiment: DIP-253546X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages. Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. Only protein-protein interactions imex curation sun-2012-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. DIP original experiment: DIP-253547X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages. Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. Only protein-protein interactions imex curation sun-2012-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. DIP original experiment: DIP-253548X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages. Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. Only protein-protein interactions imex curation terl_bpt4 Terminase, large subunit 17 Gene product 17 DNA-packaging protein protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MEQPINVLNDFHPLNEAGKILIKHPSLAERKDEDGIHWIKSQWDGKWYPEKFSDYLRLHKIVKIPNNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIKTQWTREMVEEWKKCRDDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSSIGAYASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTGVSVAKSLYMDLEYEGVICDSYTDLGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRATIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKDDMRLASEVFSKELQDMSDDYAPVIFVDSVHSAEYVPVSHGMSMV ters_bpt4 Terminase, small subunit 16 Gene product 16 Packaging protein Gp16 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MEGLDINKLLDISDLPGIDGEEIKVYEPLQLVEVKSNPQNRTPDLEDDYGVVRRNMHFQQQMLMDAAKIFLETAKNADSPRHMEVFATLMGQMTTTNREILKLHKDMKDITSEQVGTKGAVPTGQMNIQNATVFMGSPTELMDEIGDAYEAQEAREKVINGTTD q6u9f0_9caud 16 protein protein aeromonas virus 44rr2 Aeromonas virus 44RR2 MNDVLDFTQLKDLNGIEGIHGEDVQVYAPLVLRDPVSNPNNRKIDQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEMLKMHKEMKDLAGAATVAIDGQVQKDADGEFIEFEGSPDELLDLELADEDIGDD 16-17 3234680 N/A 3234684 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3234685 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 16-3 3234681 N/A 3234686 unspecified role unspecified role unspecified role unspecified role Region 26-112 Region 26-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 16-4 3234682 N/A 3234685 unspecified role unspecified role unspecified role unspecified role Region 1-41 Region 1-41 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 119-164 Region 119-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 16-5 3234683 N/A 3234686 unspecified role unspecified role unspecified role unspecified role Region 25-115 Region 25-115 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false