DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ thivierge-2011-1 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255372X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-2 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip mudpit multidimensional protein identification technology mudpit Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255354X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255369X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-4 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255364X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-5 caeel Caenorhabditis elegans molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255376X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-6 caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255361X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-7 caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255362X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-8 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255358X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-9 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255368X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-10 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255365X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-11 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255375X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-12 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255359X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-13 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255374X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-14 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255355X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-15 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255366X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-16 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255371X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-17 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255356X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-18 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255367X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-19 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255373X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-20 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255370X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-21 caeel Caenorhabditis elegans molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255377X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-22 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255357X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-23 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255360X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation thivierge-2011-24 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. DIP original experiment: DIP-255363X Nature structural & molecular biology 2011 IMEx Tudor domain ERI-5 tethers an RNA-dependent RNA polymerase to DCR-1 to potentiate endo-RNAi. Thivierge C., Makil N., Flamand M., Vasale JJ., Mello CC., Wohlschlegel J., Conte D., Duchaine TF. Only protein-protein interactions imex curation g5ebf5_caeel rde-4 T20G5.11 CELE_T20G5.11 protein protein caeel Caenorhabditis elegans MDLTKLTFESVFGGSDVPMKPSRSEDNKTPRNRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELPEGFEMTLILNEITVKGQATSKKAARQKAAVEYLRKVVEKGKHEIFFIPGTTKEEALSNIDQISDKAEELKRSTSDAVQDNDNDDSIPTSAEFPPGISPTENWVGKLQEKSQKSKLQAPIYEDSKNERTERFLVICTMCNQKTRGIRSKKKDAKNLAAWLMWKALEDGIESLESYDMVDVIENLEEAEHLLEIQDQASKIKDKHSALIDILSDKKRFSDYSMDFNVLSVSTMGIHQVLLEISFRRLVSPDPDDLEMGAEHTQTEEIMKATAEKEKLRKKNMPDSGPLVFAGHGSSAEEAKQCACKSAIIHFNTYDFTD dcr1_caeel Endoribonuclease dcr-1 dcr-1 eri-4 let-740 K12H4.8 protein protein caeel Caenorhabditis elegans MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIEIFDETVAFVNTTTEFHPDLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKIIKSQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDTAACDSDLKDFQQIEKILLSRHRTVNNPIEDDSDRFEEFDVDSQMEPYVVEKTGATLKMSTAIALINRYCSKLPSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRESIAKLLEHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYAFELERFREAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVAPKKTTVTAAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMSYTINMKYVSEVVANMENMPRIPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAEILPEWRPSSKFPDTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQPRRSRTVSNSSTSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIAALPSIFYRVNQLLLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKIQQLRDLNQKSIEDQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQDTVGLTQGLHDGNISDEDDELPFVMHDYTARLTSNRNGIGAWSGSESIVPSGWGDWDGPEPDNSPMPFQILGGPGGLNVQALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEEQFKKLQNDLLKQAKERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPTNFPKTIDEEIEELSIGARKKQEIDDNAAKTDVLERENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDIGLGVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNEIERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV g5edi8_caeel drh-1 CELE_F15B10.2 F15B10.2 protein protein caeel Caenorhabditis elegans MRKKQCSSILSLYDKEIILCLEPIYRDPEKGDGFSELLPLGRIDELKIQSENAQEFSKQLYHDLKNSILSNADDERLYKDIMTYLQTYLPKCTVHKLLNCSNREVKLSDFHYILDHFEGFLRFIEPKVVLAYLDSYPQYIDAVAVLRKEIERNEEDNQDSDFIKKLILRTVPLLGEQAVYDIMYTISEKSSNNLDVEAKQFIAKVLRLKNDGFLRFYQIINASRRQLNGRIYICPVHESATEMMVYLGTAALNTNRYRMINIRVDNIVQENSTPRLVIESVRQRIHRQRQLCLRNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLDHVYHTQIIQGSDNVPTRNVIQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYHYLKNMGNMPEGHSLPQIIGLTASLGTGDKNDCLQVRNYIAGLCASMDVKDLSIVKDNLEELRGYSPIVPDKVLLCERSTDGPIGMFTNRLTLMMQEVEGLIRTALRNEHIGIEQRRQIETTERDFRPDSSFLDPPADKEHAGYQNWVCNQMNLVSGTSFRETGTRTIINEALDVLKECFCTLSYNINFHPEVALNYLKDEMEYRTPNFTVNMIRIWERYHNQLVGTGSAENPMISKTVQYIVEQNLQRADSRTIIFVRTRYEATILNKVLNSNEELLMLGIKSEWMSGLNKSTASSADISASKQKQMEKLKMFADGEIRILVSTSVAEEGLDVPECSLVIKYNYATNEIAHVQRRGRGRALNSECVLITNSIALRDQESNNRDKESLMSETISLIQNSPAEFRKCVDEESNKIWPRILREDTDKAQKIEEQINRNIVYKIICKKCEAILCTSKDIRSRNTQYLVCDPGFWSLVRKTRLTDEQQALIKYNATGSINCRRENCGLKLGQLIEVNTVDLPCLSALSIVLLVEGTDKRIIVKKWKNILDKYFTPTEIRQLDVQTMRDADQARTPMVFEHHANGEVVNLIREA o44406-1 3'-5' exonuclease eri-1 eri-1b eri-1 Enhanced RNAi protein T07A9.5 protein protein caeel Caenorhabditis elegans MSADEPSPEDEKYLESLRDLLKISQEFDASNAKQNDEPEKTAVEVESAETRTDESEKSIDIPREQQLLPSERVEPLKSMVEPEYVKKVIRQMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEIIYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQKCSYKENQRSAARKDEERELEDAANVDLTSVDISRRDFQLWMRRLPLKLSSVTRREFINEEYLDCDSCDDLTDDKNDEAAFQEKMAIREYLENKQTEDFAKIAAERGIFKIGEIKSYQTARPIIEDDDVDVESEEEDYGTEFEMLEVVERMPPVSSTLHTEVDLDAVWERDGGSDSERENLSNAPSLHEFPSSSTSSPHATSEHVTSSSPLHIDDDVDRVLNAPPKNSLASSSNRSSF dus11_caeel RNA/RNP complex-1-interacting phosphatase homolog pir-1 Dual specificity protein phosphatase 11 homolog Phosphatase interacting with RNA/RNP complex-1 T23G7.5 protein protein caeel Caenorhabditis elegans MSNYHHNHNYQHRPRGYERLPGKRLPDRWNIYDNVGRDIDGTRFVPFKTPLDSSFFDGKNMPVELQFGVKTLISLAQQANKQIGLVIDLTNTDRYYKKTEWADHGVKYLKLNCPGHEVNEREDLVQDFINAVKEFVNDKENDGKLIGVHCTHGLNRTGYLICRYMIDVDNYSASDAISMFEYYRGHPMEREHYKKSLYEAERKKKYGKSSGKSSGNSADSTISSEQLHRNNSQ q9gzi7_caeel eri-3 CELE_W09B6.3 W09B6.3 protein protein caeel Caenorhabditis elegans MQPVLVNSRPLRVKSHESESKLNLIEQEDQFEGANYSSSSGVIICYSNGTGEVITQEAFDDSGIHFIFSKATCIQYPSNFDPIGVGSVVQIFWSRSFERVVRGNHIIVQIEKMEVYKCCAMLREQVFVTFNSPSTAGVAIGVTERNITVAFHPNCSPVIRYETLKAHSIGRTEFEIKDRHRENTNRMVDVILAAVPFRVEIHGNVDKIPFFVIEKCRNSPGRSGAAVITKIMKNHFMEANFLQNSESIYFDSTSCHSNILEKVSIGSLINVLADPTFATSSYKWYGYDVTLCNNYLAHASTQRSFVLENNEILQNCKKLEKSPEEAETTTKNDLRFVPPQPEKGEVKKKKMTNCLKFNSKSAQFKLRHLILDRCFSELPEREAKSIINSYFIDRLAEGIKIEKIDKNWRTFGEILPKTPKKYSESLKKSIQNVLEPFGLNKPEKAAETPKIVEYFPKNPKKRVEIVEKPTVDEIRELFGALMDAEGFALNQRVKPHFVLPDTRWKPTERRYIGIYDDVQWTFMSTFCPKIEENSENRPLAGGWWYRRTVPRDHPVEIVQKMETRRNIIKDCTESPFIE q93413_caeel drh-3 CELE_D2005.5 D2005.5 protein protein caeel Caenorhabditis elegans MQPTAIRLEDYDKSKLRLPFESPYFPAYFRLLKWKFLDVCVESTRNNDIGYFKLFESLFPPGKLEEIARMIIDEPTPVSHDPDMIKIRNADLDVKIRKQAETYVTLRHAHQQKVQRRRFSECFLNTVLFDEKGLRIADEVMFNYDKELYGYSHWEDLPDGWLTAETFKNKFYDEEEVTNNPFGYQKLDRVAGAARGMIIMKHLKSNPRCVSETTILAFEVFNKGNHQLSTDLVEDLLTEGPAFELKIENGEEKKYAVKKWSLHKTLTMFLAIIGFKSNDKKEKNEHEEWYYGFIDAMKNDPANRAALYFLDKNWPEELEEREKERDRIRLTLLKSQRTNEEAVGEDVCTTIRPQPKDSGYNPDAVVTELVLRTYQEELVQPALEGKNCVIVAPTGSGKTEVAIYAALKHIEERTSQGKPSRVVLLVPKIPLVGQQKDRFLKYCNGMYEVNGFHGSESSVSGTGRRDEVIATHVSVMTPQILINMLQSVRQNERLYVSDFSMMIFDEVHKAAKNHPYVLINQMVQEWKYEKPQIIGLTASLSVKVDGQKDENQMLNDIYNMLALINAPHLSTITRQSSIDELNEHVGKPDDSVELCLPAKENILRDYIERYLNHAHGKFLEELASMSKSTGRNNTIPPNMINTFKKNQPKNYEYYDSLLQGIIQELNKLNVPEKWNSQTWAKYMKVYLEARGIVDLMPAMVAFKYMEKAIGKLNESHSETVEYSTFIKDHDTLKQTIQSVEPEIVLRLKNTLTNQFHVAPESRVIIFVTQRSTAQRVSDFLNESKVLDQFGNYGEQMVGYVLGTNKQGAVQQTSQEQQLTLDKFNNGRLKVIVATSVVEEGLDVTACNLIIKYNCSSGSAIQLVQQRGRARAKNSRSVLLSVKSSINETETNALISEKYMRLCVKKITENGEKQLAAEVKRVAELNAAERKRNLEEQLNLRLRHENKIYKLMCSNCSKEFCKSIYIKKVFSNYMVFDPSVWRFLHVESKRKVSKYLSEDNQPLSDIKCFHCKLDVGRAYKIRGTYLPQLSVKALTFVQESDYSSMTKAKWSDVEQDLFYISEAIEDDFRIMLNALSDTEENIEKKIVLDLDSRQHNKQLEMKRFHIQQEPPTKGVAPEAQ g5ee53_caeel RNA-directed RNA polymerase rrf-3 CELE_F10B5.7 F10B5.7 protein protein caeel Caenorhabditis elegans MLPFDNDDSSDDATTSVRPKHPRGVPQSQSTFPRGRSNFSSGTLPNRKTECTPVNTLTIGHSNKMLLTTFRMDRNSKSKSEVDVQEQPVHSSSSAFPGNHLNNFSYPVNRGYLRDYLLQSQRPSTSKPVDCSVLKRHSLPSTHILYEKTKHRGGVNIEEQEKLVRMLWAAAEESETVAKTRQFSKKQAIELNFDAKLIGSMNNDCFGYCRAHMENIKDVLKTHLKLSKVDEVNWIKVGMVPRAAYEDKSYVIDAHLVLTPNGEVEDENELFSEFASSFTSRITGMLHDQVFLEVPKMHTLFTKITPQHMDINISAIAIGNCPNSGLFLVRGDFISQENTVCSVKLQSHHNADASRENSSFKVAGSNKYLSYARFEHDKRLAVVYFGVRLAEFADDGLDHAGFRLNLYYNLFVRIVVDMSHETTNSIYIQMKNPPHLWEGIPKNTIFHPSKSKVLNMETCTEWTRVLSWPGDAEGRGVGCTSEAFSQSSWIRLTMRKDDDNDSVSSTQLMDIVTRLSARSKAKVMFGSIFSIRRKLAPSPAFHSLGSFRANYALQALITRGSVFTDQLFDATDENIPSSDNDNDEDDDDDVDDTKKPMELVHEPLFLKLVRRGMKECSQATEETLEQLLNAFDERRQIDVVTAFTTMYQSRKIQYERLLKGESLQDVGLAKPLPKNCVSVAKVIVTPSRILLMAPEVMMVNRVVRRFGPDYALRCVFRDDNLGRLAIRDFSINNIDHMSNIVTEGIYLTLKNGIQVADRVYSFLGWSNSQMRDQGCYLYAPRVNALTGEVTGTVEDIRVWMGDFRDAISVPKMMSRMGQCFTQAQPTVRLERHHWIVEPDIEGGVENKYCFSDGCGRISIKLATHISKILQLKEVPACFQVRFKGFKGILVIDPTIDDIINMPKVIFRKSQQKFGEGGGELQDEYLEVVKYAMPSPVCLNRPFITILDQVSEKQSASSHRRITNRVHYYLERELCSLSNMLINENQAAEELVNRTNLAIDWNAASKRAGFELSVDPLIRDMLFSIYRYNIIHHISKAKIFLPPSLGRSMYGVVDETGLLQYGQVFIQYSPSIRQTSNRPILKTGKVLITKNPCHVPGDVRVFDAVWQPALAHLVDVVVFPQHGPRPHPDEMAGSDLDGDEYSIIWDQEMLLDYNEEAMVFPSSSAAEEDKEPTTDDMVEFFLRYLQQDSIGRMSHAHLAYADLHGLFHENCHAIALKCAVAVDFPKSGVPAEPLSSFEQCEMTPDYMMSGGKPMYYSTRLNGQLHRKARKVEEVLEEFETRGSVFEREYDKLICPEDVDVFFGNEIKLVQTLTLRDEYVDRMQQLLDEYGIEDEASVVSGHAASIKRLAGMERDDYSFYHTDKVVELRYEKLYAVFRAKFFEEFGGEEINIENDGKNTRLKCTKAMHEKIRQWYFVAYVQPKINKAGRCIGQSLPWVAWDALCDLRRQLMLDKNDAVLRGKYPIAARLEEEIENSIERQFDKFLKLKDLIESHKDALFLRRYVYFYGDQIIKMLFILKVWLERENVLPSSVLSIWQLGRLLIRLGLGDLLGNPTIDYEKSLLMPTTMFQQWISKKEDADEAPILRNFDMGTMMLEFLRYLASQSFASAESISLRVFYEKDIVEPILTKSAQWMPLHLIAYRTFHSIAVSGRFDALHLDDEDAVDQITESKDPILVNESLFSSRNYNDDYPISRSRILQSLKDWSGVKEIIPREITGTRKSDMIYVTSVGTVLARQRLARLLLLSGETIRDAIANNVVPNEVRDEFL q95xs0_caeel eri-5 CELE_Y38F2AR.1 Y38F2AR.1 protein protein caeel Caenorhabditis elegans MLSEEPYETYHPEFPDPEIRRIALKSSAVVELLRIESPSSFFCRPVDHVTDDQLLIREPYRLTTRIIDFSAGNMAMAPLRPRVFARCLILKNLELIEAARIFFIDSAVTANVSWKCLFQIDENLKFHPWQAMHCTLGRLVHLSDSWTDTQCTEFRNIVSKFAKFQITANQCDVDFRSDRPSLLVNLYGLPNGTEIDKKVAIEEICAVSMQNVMVSQFPTNFMVNPKLEELDKEQDHLDVILLEEFRRDLPADWAHEPPADYREDDADWDILQCHVAEWNDTALEQFRRADGSFWAMLEPSCTVSPWEMHVTPILAPEKMSDNEHWIFEQLVKNSENQQKIDDFYSNLKNQRPLEMEEIKFALQTGRTYVMATIKNRQKSSAQWLRCEIIDFLPNANVALRYVDLGTRGILKLKNLHRMHIEHTKIAPACIEIGRFLDDDLSMADSEMEWNTHFWREIVPYDVPIVVGPDMEFLETGKLQFSQIRVAGDEDDENLLDKIPSPSPFFTERSDDLRTQKEDDDDGNVSDDKDSG q19731_caeel ekl-1 CELE_F22D6.6 F22D6.6 protein protein caeel Caenorhabditis elegans MIAVGLRLTDEVFPNPEEPIAKLPTGNENPEMLLDGVNKDGKTRIKRIVLSRSANVEFLRAESPSRIWVRLTNHITDSALTFREPFELTQKTTFKIGDYALAPTDERVYRRCRIVDVCRNNELLKVFFIDDAVIAWVQPECLGELDQHYMYYPWQAIQVSMFGATPTVDVNRSTEQLWSPIICDQLSKVLEQFFILRVEVVLSTVVFNDYAKPIPVNLFGIEADIDEKDQIRRAIEIGPILERQEPVGISFPEFFDAAYHQVFEVAERETIPNEALEIHRSFPTDWKKTSISEDQMKEEKEKALFSKNSLIPEMEHSDWDPRQNSIEMLSIDQLEEKFKFPYDSDVAPAIMLAVEGRCTKSPFEWYARPIVKTGRNANGEMVIWNDEEQLKEVDPVDWMIYGNDQLLSMAEQLDTYYSNPKNRKPLKAEEIQSMRKEKRDVFAVCAVNEEKAMYTGEWQRVLIVECDTFAEVRFLDSGGRDMVLTGSLYKIHRQHCRFPPMCLRLSMHGITSSESVVRKWTSAETSRFRTCLREDVPIFINIDDIAPLILPPDDKKDPRAHMAKHVLMVSDVSYMDESKSLLDRFTDKDEAVRAAFSQKEPIEWPN g5eeh0_caeel rde-1 CELE_K08H10.7 K08H10.7 protein protein caeel Caenorhabditis elegans MSSNFPELEKGFYRHSLDPEMKWLARPTGKCDGKFYEKKVLLLVNWFKFSSKIYDREYYEYEVKMTKEVLNRKPGKPFPKKTEIPIPDRAKLFWQHLRHEKKQTDFILEDYVFDEKDTVYSVCRLNTVTSKMLVSEKVVKKDSEKKDEKDLEKKILYTMILTYRKKFHLNFSRENPEKDEEANRSYKFLKNVMTQKVRYAPFVNEEIKVQFAKNFVYDNNSILRVPESFHDPNRFEQSLEVAPRIEAWFGIYIGIKELFDGEPVLNFAIVDKLFYNAPKMSLLDYLLLIVDPQSCNDDVRKDLKTKLMAGKMTIRQAARPRIRQLLENLKLKCAEVWDNEMSRLTERHLTFLDLCEENSLVYKVTGKSDRGRNAKKYDTTLFKIYEENKKFIEFPHLPLVKVKSGAKEYAVPMEHLEVHEKPQRYKNRIDLVMQDKFLKRATRKPHDYKENTLKMLKELDFSSEELNFVERFGLCSKLQMIECPGKVLKEPMLVNSVNEQIKMTPVIRGFQEKQLNVVPEKELCCAVFVVNETAGNPCLEENDVVKFYTELIGGCKFRGIRIGANENRGAQSIMYDATKNEYAFYKNCTLNTGIGRFEIAATEAKNMFERLPDKEQKVLMFIIISKRQLNAYGFVKHYCDHTIGVANQHITSETVTKALASLRHEKGSKRIFYQIALKINAKLGGINQELDWSEIAEISPEEKERRKTMPLTMYVGIDVTHPTSYSGIDYSIAAVVASINPGGTIYRNMIVTQEECRPGERAVAHGRERTDILEAKFVKLLREFAENNDNRAPAHIVVYRDGVSDSEMLRVSHDELRSLKSEVKQFMSERDGEDPEPKYTFIVIQKRHNTRLLRRMEKDKPVVNKDLTPAETDVAVAAVKQWEEDMKESKETGIVNPSSGTTVDKLIVSKYKFDFFLASHHGVLGTSRPGHYTVMYDDKGMSQDEVYKMTYGLAFLSARCRKPISLPVPVHYAHLSCEKAKELYRTYKEHYIGDYAQPRTRHEMEHFLQTNVKYPGMSFA g5ebq3_caeel RNA-directed RNA polymerase ego-1 CELE_F26A3.3 F26A3.3 protein protein caeel Caenorhabditis elegans MGDEGYRGWIKLEIPCSLPERQMGPIVKCHVAKLEPALNEYNIKVLTKGQVQVVEEQDCEPFYETNYEVATSRFSHDLIAAIQTYLKDLSTDHLMPFQRGNLVLHSSDFWSSELTCHLVDIPLAAVFFGNIQGGTFINHWEVSFWDDVRRRKSARTRNTEPTQADKIGMNQIKVEFEFDKIDFMTVHFKHFENDFEVADKDAKRTKQTVTMYYQITVRRTSIRRIIVDPVVQDCNGSDRIRVHFELNCPVLIRRAYRTAKQESENRHSVPHYRRYLVINRGRSANQYPTAKAITDSPVFTIEFDQSVGLNEIYRLLSRLRIRTGVSIEFADIPSIDCLIWRENPYNRWTFLNNQHLSPTHFSAPIYRDFITTAFPKKHEVCGSREVDTNRERKFAITYLLECLISRGAVVKDQILLDEGIWHRFLEVILHYYTKDDKLCEAGLEDLVHMIDGRKRIGSLIKCFDRICQTRQRNSLVNGLTTEEMREGYQRVRKIIFTPTRVIYVAPETLMGNRVLRRYDHDGTRVLRITFRDDDNQKMRTNKTSTMLEKTVNQYLKNGITVAGRNFGYLGSSNSQMRDNGAYFMEKYSSSQCREYERIYQIKPPITFNPKIQAARKNLGRFETIDNIPKMMARLGQCFTQSRLSGVNLERCTYMTTYDLTGGKNLKGDEYTFSDGVGMMSYRFAQMVSEVMDFGKGVPSCFQFRFRGMKGVISIEPLLDNLRQWSISYNISKPSDDSSWSLNCMFRPSQIKFISKRHPRDQVEIVKYSSPVPVALNKPFINILDQVSEMQSLECHRRVTNRIEELLDRQMLSFAQQMVDETFCRNRLKELPRRVDIDYLRTTWGFTLSSEPFFRSLIKASIKFSITRQLRKEQIPIPCDLGRSMLGVVDETGRLQYGQIFVQYTKNLALKLPPKNAARQVLTGTVLLTKNPCIVAGDVRIFEAVDIPELHHMCDVVVFPQHGPRPHPDEMAGSDLDGDEYSIIWDQQLLLDKNEDPYDFTSEKQKASFKEDEIDDLMREFYVKYLKLDSVGQISNSHLHNSDQYGLNARVCMDLAKKNCQAVDFTKSGQPPDELERKWRKDEETGEMIPPERAERVPDYHMGNDHTPMYVSPRLCGKLFREFKAIDDVLKISEERDEQVEISIDETIKIDGYTEYMASAKNDLARYNAQLRSMMENYGIKTEGEVFSGCIVDMRNRISDKDQDDMSFFNTNQMIETKLTNLFKKYREIFFEEFEGGWEGNTEAFSRYGRDSNILQRQCRAPTVQMMKKAVAWYRACYEEARITRENKKLSFAWLAYDVIAKVKQDKSLTSDEVKMGGANPLYTMLDDHRSQYLVDNSRKFEAFRQFSTPKTSGEQVKRAHRIIKMYTETYPGLDAVLFMLDEWARISNLFENQSLREYHLSLLFILFATRQFSSVDGNAAKFFNKVDEKSYKQSKTIGDFEPSLYIEEKGKSQMMVKFLEFLASRKFRKMANLSFCALDFSSIFMRGEWQIFHLAALKTYYNVLFNLRFEELPVSTDPTTTVRSIIRENEPFVIELPANCDRSLVHRKLVEHTGVKEIFMRNMEKSVRSSDDVQKINMRLLVSTRGTLESMYKLRQLVAVKVPIKTYVTGQDVSTQMARLCYEKIVRGHINI eri1_caeel 3'-5' exonuclease eri-1 Enhanced RNAi protein eri-1 T07A9.5 protein protein caeel Caenorhabditis elegans MSADEPSPEDEKYLESLRDLLKISQEFDASNAKQNDEPEKTAVEVESAETRTDESEKSIDIPREQQLLPSERVEPLKSMVEPEYVKKVIRQMDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYYRKENALLNRKMEPNADKTARFFDYLIAIDFECTCVEIIYDYPHEIIELPAVLIDVREMKIISEFRTYVRPVRNPKLSEFCMQFTKIAQETVDAAPYFREALQRLYTWMRKFNLGQKNSRFAFVTDGPHDMWKFMQFQCLLSNIRMPHMFRSFINIKKTFKEKFNGLIKGNGKSGIENMLERLDLSFVGNKHSGLDDATNIAAIAIQMMKLKIELRINQKCSYKENQRSAARKDEERELEDAANVDLTSVDISRRDFQLWMRRLPLKLSSVTRREFINEEYLDCDSCDDLTDDKNDEAAFQEKMAIREYLENKQTEDFAKIAAERGIFKIGEIKSYQTARPIIEDDDVDVESEEEDYGTEFEMLEVVERMPPVSSTLHTEVDLDAVWERDGGSDSERENLSNAPSLHEFPSSSTSSPHATSEHVTSSSPLHIDDDVDRVLNAPPKNSLASSSNRSSF dcr_1-drh_1-1 3234292 N/A 3234316 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false eri_5-dcr_1-1 3234293 N/A 3234319 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234320 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234321 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234322 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234324 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association false false false dcr_1-eri_3-1 3234294 N/A 3234321 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3234317 unspecified role unspecified role bait bait Region 220-427 Region 220-427 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 272-1045 Region 272-1045 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false rrf_3-ekl_1-1 3234295 N/A 3234325 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association false false false dcr_1-drh_1-2 3234296 N/A 3234318 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans physical association physical association false false false rde_4-dcr_1-1 3234297 N/A 3234326 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false rde_1-dcr_1-1 3234298 N/A 3234326 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false drh_1-dcr_1-1 3234299 N/A 3234326 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association false false false eri_5-rrf_3-1 3234300 N/A 3234324 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role prey prey caeel Caenorhabditis elegans physical association physical association false false false dcr_1-drh_3-1 3234301 N/A 3234322 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234324 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false rde_4-rde_1-1 3234302 N/A 3234326 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association false false false rde_4-dcr_1-2 3234303 N/A 3234326 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false rde_4-dcr_1-3 3234304 N/A 3234316 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false drh_1-dcr_1-2 3234305 N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association false false false eri_5-dcr_1-2 3234306 N/A 3234322 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234324 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false dcr_1-eri_3-2 3234307 N/A 3234324 unspecified role unspecified role prey prey CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3234321 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3234317 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 272-1045 Region 272-1045 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false eri_5-drh_3-1 3234308 N/A 3234322 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234324 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association false false false ekl_1-ego_1-1 3234309 N/A 3234327 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234325 unspecified role unspecified role bait bait caeel Caenorhabditis elegans physical association physical association false false false drh_1-dcr_1-3 3234310 N/A 3234316 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association false false false dcr_1-eri_5-1 3234311 N/A 3234324 unspecified role unspecified role prey prey CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3234317 unspecified role unspecified role bait bait Region 220-427 Region 220-427 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 272-1045 Region 272-1045 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false dcr_1-drh_3-2 3234312 N/A 3234322 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234328 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234324 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans physical association physical association false false false dcr_1-drh_1-3 3234313 N/A 3234326 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234316 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false dcr_1-drh_1-4 3234314 N/A 3234317 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3234318 unspecified role unspecified role prey prey caeel Caenorhabditis elegans physical association physical association false false false rrf_3-dcr_1-1 3234315 N/A 3234325 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234324 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234317 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3234323 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association false false false