DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ charles-2011-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. DIP original experiment: DIP-253806X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Ligand-binding properties of a juvenile hormone receptor, Methoprene-tolerant. Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. Only protein-protein interactions imex curation charles-2011-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. DIP original experiment: DIP-253808X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Ligand-binding properties of a juvenile hormone receptor, Methoprene-tolerant. Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. Only protein-protein interactions imex curation charles-2011-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. DIP original experiment: DIP-253807X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Ligand-binding properties of a juvenile hormone receptor, Methoprene-tolerant. Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. Only protein-protein interactions imex curation charles-2011-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. DIP original experiment: DIP-253809X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Ligand-binding properties of a juvenile hormone receptor, Methoprene-tolerant. Charles JP., Iwema T., Epa VC., Takaki K., Rynes J., Jindra M. Only protein-protein interactions imex curation a6mut7_trica Met TcasGA2_TC003908 protein protein red flour beetle Tribolium castaneum Red flour beetle MDSGDCETEEDSAPEACVSPEGSLLPSNSREMRNRAEKMRRDKLNSYIGELATLVPMVARSAKRMDKTSILRLAATHLRIYQTLLSGKNHPHIQLPKHVDQYLLEQLVCEQLGGFLLILTPNGKIVFVSHTVEHLLGHLQTDLMGQSIFNITSPDDHDRLRMYINTESVLDGDWKKCFNIRLKRAGPRTESAVYEPVRIMGVHRPGFDNDCNKNTSTSKEIALNNDVLLFFVKVFRPEPLCERLFEASREEYVTRHLIDGRIIGCDQRISFIAGYMTEEVSGLSAFKFMHREDVRWVMIALRQMYDRGESKGSSCYRLLSRNGQFIYLRTFGFLEIDDQGTVESFVCVNTLVSEQEGLQLINEMKKRYSALINSQSCPITSSGSTDSSSQSVEDPQQVEAAIVHLIANLPSPGSDQRSTPSPRVYGNVNENQDCSTPTENSPTKPYYKLKTANNKRPPSTELGTNIYTSSKRQRTSPQLSPMSSLPPYPNRTQITEVTQQTEPSIYQHDQLLRNKV tctaiman PREDICTED: similar to transcriptional intermediary factor 2 protein protein red flour beetle Tribolium castaneum Red flour beetle met-met-1 3234095 N/A 3234099 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3234099 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 240-516 Region 240-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false tctaiman-met-1 3234096 N/A 3234100 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false human Homo sapiens Human N/A 3234099 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false A6MUT7:p.Val297Phe V297F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false A6MUT7:p.Val280Phe V280F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region 241-516 Region 241-516 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false met-met-2 3234097 N/A 3234099 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-240 Region 1-240 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3234099 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false met-tctaiman-1 3234098 N/A 3234100 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false human Homo sapiens Human N/A 3234099 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false A6MUT7:p.Val297Phe V297F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region 240-516 Region 240-516 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false