DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ galkin-2011-1 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Galkin VE., Orlova A., Kudryashov DS., Solodukhin A., Reisler E., Schröder GF., Egelman EH. DIP original experiment: DIP-249737X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Remodeling of actin filaments by ADF/cofilin proteins. Galkin VE., Orlova A., Kudryashov DS., Solodukhin A., Reisler E., Schröder GF., Egelman EH. Only protein-protein interactions imex curation galkin-2011-2 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Galkin VE., Orlova A., Kudryashov DS., Solodukhin A., Reisler E., Schröder GF., Egelman EH. DIP original experiment: DIP-249738X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Remodeling of actin filaments by ADF/cofilin proteins. Galkin VE., Orlova A., Kudryashov DS., Solodukhin A., Reisler E., Schröder GF., Egelman EH. Only protein-protein interactions imex curation actb_chick Actin, cytoplasmic 1 ACTB Beta-actin protein protein chick Gallus gallus (Chicken) Chicken MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF mint Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells cof2_human Cofilin-2 CFL2 Cofilin, muscle isoform protein protein human Homo sapiens Human MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL actb-cfl2-8 3233979 N/A 3233981 unspecified role unspecified role unspecified role unspecified role chick Gallus gallus (Chicken) Chicken N/A 3233982 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false actb-6 3233980 N/A 3233981 unspecified role unspecified role unspecified role unspecified role chick Gallus gallus (Chicken) Chicken direct interaction direct interaction false false false