DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mahankali-2011-1 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. DIP original experiment: DIP-253823X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phospholipase D2 (PLD2) is a guanine nucleotide exchange factor (GEF) for the GTPase Rac2. Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. Only protein-protein interactions imex curation mahankali-2011-2 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. DIP original experiment: DIP-253826X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phospholipase D2 (PLD2) is a guanine nucleotide exchange factor (GEF) for the GTPase Rac2. Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. Only protein-protein interactions imex curation mahankali-2011-3 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. DIP original experiment: DIP-253824X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phospholipase D2 (PLD2) is a guanine nucleotide exchange factor (GEF) for the GTPase Rac2. Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. Only protein-protein interactions imex curation mahankali-2011-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down anti tag western anti tag western blot anti tag western Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. DIP original experiment: DIP-253825X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phospholipase D2 (PLD2) is a guanine nucleotide exchange factor (GEF) for the GTPase Rac2. Mahankali M., Peng HJ., Henkels KM., Dinauer MC., Gomez-Cambronero J. Only protein-protein interactions imex curation rac2_human Ras-related C3 botulinum toxin substrate 2 p21-Rac2 Small G protein GX RAC2 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL pld2_human Phospholipase D2 Choline phosphatase 2 Phosphatidylcholine-hydrolyzing phospholipase D2 PLD1C PLD2 protein protein human Homo sapiens Human MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT pld2-rac2-1 3233051 N/A 3233055 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3233056 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false pld2-rac2-2 3233052 N/A 3233055 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3233056 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 255-270/306-326 Region 255-270/306-326 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false pld2-rac2-3 3233053 N/A 3233055 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3233056 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false rac2-pld2-1 3233054 N/A 3233055 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3233056 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false