DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bange-2011-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220380X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220388X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220390X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-4 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220382X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220386X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-6 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220384X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220381X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220389X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220385X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-10 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220383X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation bange-2011-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. DIP original experiment: DIP-220387X Nature structural & molecular biology 2011 IMEx Structural basis for the molecular evolution of SRP-GTPase activation by protein. Bange G., Kümmerer N., Grudnik P., Lindner R., Petzold G., Kressler D., Hurt E., Wild K., Sinning I. Only protein-protein interactions imex curation ylxh_bacsu Flagellum site-determining protein YlxH ylxH BSU16410 protein protein bacsu Bacillus subtilis MQMNRYDQAATLRAKMEKRERVLPMVYSQKAKTLAVISGKGGVGKSNITLNMALALQDKGKKVLLIDLDIGMGNIDILIGNSSSATIIDVLTDRKPLLQSLSVGPKGLRYISGGTGLDVMFQLDQRKWTFFANELSHALSQFDYVLFDMGAGLSKDQLPFILSAEDILIITTPEPTAIMDAYSAVKHLVLTENKLSMKVAVNRCRDQKEGLDAFARLSRTIHMFLDVQVQFAGSVSDDVIVSKAVVEQVPFFIKSPQAKASRSVRILADALFEREETRHKEDKQTFIEKLSSFLMRRA AF6FE71FA3C1C972 flhf_bacsu Flagellar biosynthesis protein FlhF flhF Flagella-associated GTP-binding protein BSU16400 protein protein bacsu Bacillus subtilis MKIKKFTAASMQEAALLIRKELGNEAVILNSKKIKKRKWFGLVNKPAVEVIAVLDQDFLEKKTPQKAAEPKQTLKTPVSSPKIEERTYPPQIPAQQELGDFSAYQSVLPEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR E5A3577E49D16F1C p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD lt_sv40 Large T antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET flhf-ylxh-1 3232077 N/A 3232088 unspecified role unspecified role unspecified role unspecified role Region 1-23 Region 1-23 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3232089 unspecified role unspecified role unspecified role unspecified role Region 79-366 Region 79-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false p53-sv40it-1 3232078 N/A 3232090 unspecified role unspecified role bait bait Region 72-390 Region 72-390 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 3232091 unspecified role unspecified role prey prey Region 87-708 Region 87-708 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false ylxh-flhf-1 3232079 N/A 3232088 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-27 Region 1-27 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3232089 unspecified role unspecified role prey prey Region 79-366 Region 79-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q01960:p.Arg216Ala R216A mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flhf-ylxh-2 3232080 N/A 3232088 unspecified role unspecified role unspecified role unspecified role Region 1-23 Region 1-23 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3232089 unspecified role unspecified role unspecified role unspecified role Region 79-366 Region 79-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flhf-ylxh-3 3232081 N/A 3232089 unspecified role unspecified role bait bait Region 79-366 Region 79-366 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3232088 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false flhf-ylxh-4 3232082 N/A 3232088 unspecified role unspecified role unspecified role unspecified role Region 1-27 Region 1-27 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P40742:p.Gln8Ala Q8A mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3232089 unspecified role unspecified role unspecified role unspecified role Region 79-366 Region 79-366 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ylxh-flhf-2 3232083 N/A 3232088 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false This tag was used for western blot detection. Region 1-27 Region 1-27 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3232089 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 79-366 Region 79-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ylxh-flhf-3 3232084 N/A 3232088 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region Δ1-27 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3232089 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 79-366 Region 79-366 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ylxh-flhf-4 3232085 N/A 3232089 unspecified role unspecified role prey prey Region 79-366 Region 79-366 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3232088 unspecified role unspecified role bait bait region Δ1-27 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false flhf-ylxh-5 3232086 N/A 3232088 unspecified role unspecified role unspecified role unspecified role Region 1-27 Region 1-27 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3232089 unspecified role unspecified role unspecified role unspecified role Region 79-366 Region 79-366 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q01960:p.Arg216Ala R216A mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false flhf-flhf-3 3232087 N/A 3232089 unspecified role unspecified role prey prey Region 79-366 Region 79-366 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3232089 unspecified role unspecified role bait bait Region 79-366 Region 79-366 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false