DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ span-2011-1 in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Spanò S., Liu X., Galán JE. DIP original experiment: DIP-250169X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Proteolytic targeting of Rab29 by an effector protein distinguishes the intracellular compartments of human-adapted and broad-host Salmonella. Spanò S., Liu X., Galán JE. Only protein-protein interactions imex curation o14966-1 Ras-related protein Rab-7L1 RAB29 RAB7L1 Rab-7-like protein 1 Ras-related protein Rab-29 protein protein human Homo sapiens Human MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC h9l447_salty STM1055 protein protein salty Salmonella typhimurium MLRHIQNSLGSVYRSNTATPQGQIIHHRNFQSQFDTTGNTLYNNCWVCSLNVIKSRDGNNYSALEDITSDNQAFNNILEGIDIIECENLLKEMNVQKIPESSLFTNIKEALQAEVFNSTVEDDFESFISYELQNHGPLMLIRPSLGSECLHAECIVGYDSEVKKVLIYDSMNTSPEWQSNIDVYDKLTLAFNDKYKNEDCSICGLYYDGVYEPKPLHSSSWKDWCTIL h9l447_salty-rab29-1 3232002 N/A 3232003 enzyme target enzyme target substrate substrate unspecified role unspecified role MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3232004 enzyme enzyme unspecified role unspecified role MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli protein cleavage protein cleavage false false false