IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rosental-2011-2 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Rosental B., Brusilovsky M., Hadad U., Oz D., Appel MY., Afergan F., Yossef R., Rosenberg LA., Aharoni A., Cerwenka A., Campbell KS., Braiman A., Porgador A. angel@bgu.ac.il Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Only protein-protein interactions rosental-2011-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Rosental B., Brusilovsky M., Hadad U., Oz D., Appel MY., Afergan F., Yossef R., Rosenberg LA., Aharoni A., Cerwenka A., Campbell KS., Braiman A., Porgador A. angel@bgu.ac.il Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Only protein-protein interactions rosental-2011-1 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Rosental B., Brusilovsky M., Hadad U., Oz D., Appel MY., Afergan F., Yossef R., Rosenberg LA., Aharoni A., Cerwenka A., Campbell KS., Braiman A., Porgador A. angel@bgu.ac.il Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Only protein-protein interactions rosental-2011-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Rosental B., Brusilovsky M., Hadad U., Oz D., Appel MY., Afergan F., Yossef R., Rosenberg LA., Aharoni A., Cerwenka A., Campbell KS., Braiman A., Porgador A. angel@bgu.ac.il Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Only protein-protein interactions rosental-2011-5 mouse-bw5147 (TIB-48) mouse-bw5147(tib-48)_thymus lymphoma t-lymphoblast cells Mouse bw5147(tib-48) ATCC TIB-47 facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Rosental B., Brusilovsky M., Hadad U., Oz D., Appel MY., Afergan F., Yossef R., Rosenberg LA., Aharoni A., Cerwenka A., Campbell KS., Braiman A., Porgador A. angel@bgu.ac.il Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Only protein-protein interactions nctr2_human Natural cytotoxicity triggering receptor 2 NCR2 Lymphocyte antigen 95 homolog NK cell-activating receptor Natural killer cell p44-related protein LY95 protein protein human Homo sapiens Human MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS cd3z_mouse T-cell surface glycoprotein CD3 zeta chain Cd247 Cd3z Tcrz T-cell receptor T3 zeta chain protein protein mouse Mus musculus Mouse MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR mint pcna-ncr2-3 2969520 N/A 2969525 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969526 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 A/B/D Other rNK receptors, LIR1, NKG2D, KIR2DL4, NKp30, and NKp46 bound only marginally and their weak background binding was not affected by the amount of PCNA . anti-NKp44 antibody ncr2-pcna-1 2969520 N/A 2969525 unspecified role unspecified role bait bait purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969526 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 C ncr2-pcna-3 2969521 N/A 2969525 unspecified role unspecified role bait bait purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969526 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false 2A ncr2-pcna-4 2969521 N/A 2969525 unspecified role unspecified role bait bait purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969526 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 2Ai pcna-ncr2-2 2969522 N/A 2969525 unspecified role unspecified role bait bait purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969526 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 E ncr2-pcna-2 2969523 N/A 2969525 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 N/A 2969526 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 2969523 1F ncr2-pcna-5 2969524 N/A 2969527 unspecified role unspecified role ancillary ancillary transmembrane+tail_domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 2969525 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 2969526 unspecified role unspecified role bait bait whole_molecule sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 2969562 2969558 physical association physical association false false false 2C PCNA was presented on the cell surface, by expressing PCNA fused to the TCR-zeta-chain.