DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schoebel-2011-1 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250176X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250171X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-3 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250178X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250174X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250172X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250175X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-7 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250177X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation schoebel-2011-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Schoebel S., Cichy AL., Goody RS., Itzen A. DIP original experiment: DIP-250173X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein LidA from Legionella is a Rab GTPase supereffector. Schoebel S., Cichy AL., Goody RS., Itzen A. Only protein-protein interactions imex curation rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC q5zwz3_legph lpg0940 protein protein legph Legionella pneumophila subsp. pneumophila MAKDNKSHQVKTSEGSLESVKTKEKEPVLEKMRVEDSKKEDKLSMPTTKKESQPNEPVKPFKTSFEKWIESSLLDPQAKEDRGSTINLGREGLKNASQVKKFLLSPAGKDVIAELGAQMALQRNINLQNQQDRMEHELFKRRLMAALFLWYLSKKSHAAEKVKEIIREYNEKAIKNAEKASKPSQQSTSSTSQADKEIQKMLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSEELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHEGQFYLLQKGQWDAIKNNPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKEKSFFNEKGEEVTSLNDAHYVIGKDQQLFNLGGKFYPIHKEQKILEKDGKFYLLKQGEDWESIKDSPEKQKKAEHDFHKLQYETPMTVKKLVHHNKGLETTIHKERVEETKQQLEDNGKEKIEIANNISKLQSTVGVALNQLNQPTLDTESPVLTPSGGSTTSSPKPTPSLASVTTFFKTKIDEMKKNENVKVTFDDLLALSIKIADPKARTYFTGELLKEVPRSGAIPFQTMQRMLQTLEQYGVDTTKPSVTSIRSKTDEVLEQRFNPTPSLSPFKTS rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL p20340-1 Ras-related protein Rab-6A Rab-6a RAB6A RAB6 protein protein human Homo sapiens Human MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC q5zwz3_legph-rab1b-1 3231562 N/A 3231570 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab8a-1 3231563 N/A 3231572 unspecified role unspecified role unspecified role unspecified role Region 6-176 Region 6-176 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab8a-2 3231564 N/A 3231572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab6a-1 3231565 N/A 3231573 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab8a-3 3231566 N/A 3231572 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab1b-2 3231567 N/A 3231570 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab6a-2 3231568 N/A 3231573 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role Region 201-583 Region 201-583 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q5zwz3_legph-rab1b-3 3231569 N/A 3231570 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3231571 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false