DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lee-2011-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220091X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation lee-2011-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220088X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation lee-2011-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220094X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation lee-2011-9 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220089X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation lee-2011-10 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220092X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation lee-2011-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220090X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation lee-2011-12 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. DIP original experiment: DIP-220093X Structure (London, England : 1993) 2011 IMEx Crystal structure of a BCL-W domain-swapped dimer: implications for the function of BCL-2 family proteins. Lee EF., Dewson G., Smith BJ., Evangelista M., Pettikiriarachchi A., Dogovski C., Perugini MA., Colman PM., Fairlie WD. Only protein-protein interactions imex curation bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK puma PUMA peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) EEQWAREIGAQLRRMADDLNAQYERR bim BIM peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DMRPEIWIAQELRRIGDEFNAYYARR bad-bcl2l2-1 3231326 N/A 3231333 unspecified role unspecified role unspecified role unspecified role BH3 domain Region 103-127 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3231334 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bcl2l2-1 3231327 N/A 3231334 unspecified role unspecified role unspecified role unspecified role Q92843:p.[Gln88Arg;Gly89Asp;Pro91Val;Leu96Ile] Q88R/G89D/P91V/L96I mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q92843:p.Cys29Ser C29S mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2l2-puma-1 3231328 N/A 3231335 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3231334 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bcl2l2-4 3231329 N/A 3231334 unspecified role unspecified role unspecified role unspecified role Q92843:p.Cys29Ser C29S mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2l2-bim-1 3231330 N/A 3231336 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3231334 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bcl2l2-5 3231331 N/A 3231334 unspecified role unspecified role unspecified role unspecified role Q92843:p.Cys29Ser C29S mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcl2l2-bim-2 3231332 N/A 3231336 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3231334 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false