DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ johnston-2011-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Johnston CA., Whitney DS., Volkman BF., Doe CQ., Prehoda KE. DIP original experiment: DIP-250170X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing. Johnston CA., Whitney DS., Volkman BF., Doe CQ., Prehoda KE. Only protein-protein interactions imex curation q9vb22_drome pins raps Dmel\CG5692 PINS Pins Rad Raps rad rapsyn Dmel_CG5692 CG5692 RAPS dLGN dPins protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSLSASAENVSSLGLGSGGGGTTSHDGNSQQGSGSDGGSSMCLELALEGERLCKAGDCRAGVAFFQAAIQAGTEDLRTLSAIYSQLGNAYFYLGDYNKAMQYHKHDLTLAKSMNDRLGEAKSSGNLGNTLKVMGRFDEAAICCERHLTLARQLGDRLSEGRALYNLGNVYHAKGKHLGQRNPGKFGDDVKEALTRAVEFYQENLKLMRDLGDRGAQGRACGNLGNTYYLLGDFQAAIEHHQERLRIAREFGDRAAERRANSNLGNSHIFLGQFEDAAEHYKRTLALAVELGEREVEAQSCYSLGNTYTLLHEFNTAIEYHNRHLAIAQELGDRIGEARACWSLGNAHSAIGGHERALKYAEQHLQLAKELHDPVGESTARVNISDLRKLLGMPDSEPSPTEEEARSTASDHSASGNQSDGSENSQGRMVRVRRQSMEQLDLIKITPDGKRMQEEKLRAQATRKAKDDDFFEMLSRSQSKRMDDQRCSIKVNPAGAPAVATGATRKPLVQQNSLFVDPTNLPGLKSPSSANPSAIGHGPLARSATTTQQPDDDFLDMLMRCQGSRLEEQRSELPRPNVTMDAEAEAPPRSVPEAAVPGAPRGQTGRGATVPDEDFFSLIMKVQSGRMEDQRASIPFRNANNNNNSRSNNNGSAGGAGK kgua_yeast Guanylate kinase GUK1 YDR454C D9461.39 GMP kinase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFIFAEK 5DC4D2A22594BFB8 pins-scgk-1 3231193 N/A 3231194 unspecified role unspecified role bait bait LINKER domain Region 399-466 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3231195 unspecified role unspecified role prey prey P15454:p.Ser35Pro S35P mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false