DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cheng-2011-13 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220353X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions imex curation cheng-2011-14 in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220358X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions imex curation cheng-2011-15 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220356X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions imex curation cheng-2011-16 trini Trichoplusia ni (Cabbage looper) Cabbage looper dls dynamic light scattering dls predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220354X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions imex curation cheng-2011-17 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220357X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions imex curation cheng-2011-18 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. DIP original experiment: DIP-220355X Nature structural & molecular biology 2011 IMEx Crystal structures of the extracellular domain of LRP6 and its complex with DKK1. Cheng Z., Biechele T., Wei Z., Morrone S., Moon RT., Wang L., Xu W. Only protein-protein interactions imex curation lrp6_human Low-density lipoprotein receptor-related protein 6 LRP6 protein protein human Homo sapiens Human MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS dkk1_human Dickkopf-related protein 1 SK DKK1 UNQ492/PRO1008 protein protein human Homo sapiens Human MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH lrp6-1 3231128 N/A 3231134 unspecified role unspecified role unspecified role unspecified role E1E4 omain Region 20-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-7 3231129 N/A 3231135 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3231134 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false E1E2 domain Region 20-629 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-8 3231130 N/A 3231135 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3231134 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-5 3231131 N/A 3231134 unspecified role unspecified role unspecified role unspecified role E1E4 omain Region 20-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-9 3231132 N/A 3231135 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3231134 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-10 3231133 N/A 3231135 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 183-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3231134 unspecified role unspecified role unspecified role unspecified role E3E4 domain Region 630-1244 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false