DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yamashita-2011-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. DIP original experiment: DIP-249708X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the octameric pore of staphylococcal γ-hemolysin reveals the β-barrel pore formation mechanism by two components. Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. Only protein-protein interactions imex curation yamashita-2011-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. DIP original experiment: DIP-249709X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the octameric pore of staphylococcal γ-hemolysin reveals the β-barrel pore formation mechanism by two components. Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. Only protein-protein interactions imex curation hlga_staam Gamma-hemolysin component A hlgA hlg2 SAV2419 H-gamma-2 H-gamma-II protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNIQFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDLINYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNSKGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFITTLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHEVKIKSITPK a0a0h3jx61_staam hlgB SAV2421 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQICWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK hlga-lukf-1 3294466 N/A 3294468 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294469 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hlga-lukf-2 3294467 N/A 3294468 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294469 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false