DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ johnson-2011-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Johnson SA., Kim H., Erickson B., Bentley DL. DIP original experiment: DIP-220332X Nature structural & molecular biology 2011 IMEx The export factor Yra1 modulates mRNA 3' end processing. Johnson SA., Kim H., Erickson B., Bentley DL. Only protein-protein interactions imex curation johnson-2011-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Johnson SA., Kim H., Erickson B., Bentley DL. DIP original experiment: DIP-220334X Nature structural & molecular biology 2011 IMEx The export factor Yra1 modulates mRNA 3' end processing. Johnson SA., Kim H., Erickson B., Bentley DL. Only protein-protein interactions imex curation johnson-2011-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Johnson SA., Kim H., Erickson B., Bentley DL. DIP original experiment: DIP-220333X Nature structural & molecular biology 2011 IMEx The export factor Yra1 modulates mRNA 3' end processing. Johnson SA., Kim H., Erickson B., Bentley DL. Only protein-protein interactions imex curation johnson-2011-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Johnson SA., Kim H., Erickson B., Bentley DL. DIP original experiment: DIP-220335X Nature structural & molecular biology 2011 IMEx The export factor Yra1 modulates mRNA 3' end processing. Johnson SA., Kim H., Erickson B., Bentley DL. Only protein-protein interactions imex curation yra1_yeast RNA annealing protein YRA1 YRA1 D9481.2 D9509.1 YDR381W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSANLDKSLDEIIGSNKAGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKNTRAPPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTGMANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPNQRPVKSLADRIKAMPQKGGNAPRPVKRGPNRKAAMAKSQNKPKREKPAKKSLEDLDKEMADYFEKK 480B5B6DC0D14BE9 pcf11_yeast Protein PCF11 PCF11 YDR228C YD9934.13C protein 1 of CF I protein protein yeast Saccharomyces cerevisiae Baker's yeast MDHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASALHQKNLQAMLPTPTVPLLLRDIDKLTCLTSERLKNQPNDEKLKMKLLVLSQLKQELKREKLTLNALKQVQMQLRQVFSQDQQVLQERMRYHELQQQQQQQQQQQQQQQQQQQQYHETKDMVGSYTQNSNSAIPLFGNNSDTTNQQNSLSSSLFGNISGVESFQEIEKKKSLNKINNLYASLKAEGLIYTPPKESIVTLYKKLNGHSNYSLDSHEKQLMKNLPKIPLLNDILSDCKAYFATVNIDVLNNPSLQLSEQTLLQENPIVQNNLIHLLYRSKPNKCSVCGKRFGNSESEKLLQNEHLDWHFRINTRIKGSQNTANTGISNSNLNTTTTRKNIQSRNWYLSDSQWAAFKDDEITSTKHKNDYTDPHANKNIDKSALNIHADENDEGSVDNTLGSDRSNELEIRGKYVVVPETSQDMAFKCPICKETVTGVYDEESGEWVWKNTIEVNGKYFHSTCYHETSQNSSKSNSGKVGLDDLKKLVTK 66F91BA9577E82F1 clp1_yeast mRNA cleavage and polyadenylation factor CLP1 CLP1 YOR250C protein protein yeast Saccharomyces cerevisiae Baker's yeast MASLPGIDEHTTSEELITGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE B00F7659E83090DA sub2_yeast ATP-dependent RNA helicase SUB2 SUB2 Suppressor of BRR1 protein 2 YDL084W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNNNTAAGDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN AB3605A8C38A560C yra1-pcf11-1 3230790 N/A 3230794 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3230795 unspecified role unspecified role prey prey Zinc-finger domain Region 420-608 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false pcf11-clp1-8 3230791 N/A 3230796 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3230795 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false yra1-pcf11-2 3230792 N/A 3230795 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3230797 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3230794 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sub2-pcf11-1 3230793 N/A 3230795 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3230797 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false