DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bourhis-2011-1 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220071X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220075X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-3 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220072X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220076X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-5 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220080X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-6 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220077X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-7 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220083X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-8 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220073X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-9 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220078X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-10 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220081X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-11 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220084X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-12 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220074X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-13 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220082X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation bourhis-2011-14 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. DIP original experiment: DIP-220079X Structure (London, England : 1993) 2011 IMEx Wnt antagonists bind through a short peptide to the first β-propeller domain of LRP5/6. Bourhis E., Wang W., Tam C., Hwang J., Zhang Y., Spittler D., Huang OW., Gong Y., Estevez A., Zilberleyb I., Rouge L., Chiu C., Wu Y., Costa M., Hannoush RN., Franke Y., Cochran AG. Only protein-protein interactions imex curation dkk1_human Dickkopf-related protein 1 SK DKK1 UNQ492/PRO1008 protein protein human Homo sapiens Human MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH lrp6_human Low-density lipoprotein receptor-related protein 6 LRP6 protein protein human Homo sapiens Human MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS sost_human Sclerostin SOST UNQ2976/PRO7455/PRO7476 protein protein human Homo sapiens Human MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY dkk2_human Dickkopf-related protein 2 DKK2 UNQ682/PRO1316 protein protein human Homo sapiens Human MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI wnt9b_mouse Protein Wnt-9b Wnt9b Wnt14b Wnt15 Protein Wnt-14b Protein Wnt-15 protein protein mouse Mus musculus Mouse MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR mint wnt3a_human Protein Wnt-3a WNT3A protein protein human Homo sapiens Human MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK lrp6-dkk1-2 3230692 N/A 3230706 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E1 domain Region 20-325 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false E3E4 domain Region 631-1253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-sost-2 3230693 N/A 3230708 unspecified role unspecified role unspecified role unspecified role Region 115-121 Region 115-121 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3230707 unspecified role unspecified role unspecified role unspecified role E1 domain Region 20-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-dkk2-1 3230694 N/A 3230709 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3230707 unspecified role unspecified role bait bait E1 domain Region 20-325 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false E3E4 domain Region 631-1253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-4 3230695 N/A 3230706 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role unspecified role unspecified role E1E4 domain Region 20-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-wnt9b-1 3230696 N/A 3230710 unspecified role unspecified role prey prey Region 24-359 Region 24-359 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3230707 unspecified role unspecified role bait bait E1E2 domain Region 20-631 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-5 3230697 N/A 3230706 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role unspecified role unspecified role E1E4 domain Region 20-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-dkk1-3 3230698 N/A 3230706 unspecified role unspecified role prey prey O94907:p.His204Glu H204E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O94907:p.Lys211Glu K211E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E3E4 domain Region 631-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-sost-3 3230699 N/A 3230708 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E1 domain Region 20-325 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-dkk1-4 3230700 N/A 3230706 unspecified role unspecified role prey prey O94907:p.Asn40Ala N40A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O94907:p.Ile42Glu I42E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-dkk1-5 3230701 N/A 3230706 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O75581:p.Asp98Tyr D98Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Arg141Met R141M mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Asn185Ser N185S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Ala201Val A201V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Ala229Thr A229T mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-wnt3a-3 3230702 N/A 3230711 unspecified role unspecified role prey prey Region 19-352 Region 19-352 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3230707 unspecified role unspecified role bait bait E1E4 domain Region 20-1253 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dkk1-lrp6-6 3230703 N/A 3230706 unspecified role unspecified role unspecified role unspecified role Region 38-44 Region 38-44 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3230707 unspecified role unspecified role unspecified role unspecified role E1 domain Region 20-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-sost-4 3230704 N/A 3230708 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O75581:p.Asp98Tyr D98Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Arg141Met R141M mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Asn185Ser N185S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Ala201Val A201V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O75581:p.Ala229Thr A229T mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false lrp6-sost-5 3230705 N/A 3230708 unspecified role unspecified role prey prey Q9BQB4:p.Asn117Ala N117A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9BQB4:p.Ile119Glu I119E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3230707 unspecified role unspecified role bait bait E1E2 domain Region 20-631 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false