DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sauer-2011-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sauer DB., Zeng W., Raghunathan S., Jiang Y. DIP original experiment: DIP-249707X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation. Sauer DB., Zeng W., Raghunathan S., Jiang Y. Only protein-protein interactions imex curation q81hw2_baccr BC_0669 protein protein baccr Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKE q81hw2_baccr-10 3230639 N/A 3230640 unspecified role unspecified role unspecified role unspecified role Region 20-114 Region 20-114 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false