DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ arad-2011-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216797X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation arad-2011-2 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216793X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation arad-2011-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216795X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation arad-2011-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216799X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation arad-2011-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216794X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation arad-2011-6 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216796X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation arad-2011-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. DIP original experiment: DIP-216798X PLoS biology 2011 IMEx Binding of superantigen toxins into the CD28 homodimer interface is essential for induction of cytokine genes that mediate lethal shock. Arad G., Levy R., Nasie I., Hillman D., Rotfogel Z., Barash U., Supper E., Shpilka T., Minis A., Kaempfer R. Only protein-protein interactions imex curation etxa_staau Enterotoxin type A entA SEA protein protein staau Staphylococcus aureus MKKTAFTLLLFIALTLTTSPLVNGSEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS p10747-1 T-cell-specific surface glycoprotein CD28 CD28 TP44 protein protein human Homo sapiens Human MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS etxb_staau Enterotoxin type B entB SEB protein protein staau Staphylococcus aureus MYKRLFISHVILIFALILVISTPNVLAESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK p42081-3 T-lymphocyte activation antigen CD86 CD86 CD28LG2 Activation B7-2 antigen B70 BU63 CTLA-4 counter-receptor B7.2 FUN-1 protein protein human Homo sapiens Human MGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF cd28-enta-1 3230589 N/A 3230596 unspecified role unspecified role prey prey Mature protein Region 25-257 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3230597 unspecified role unspecified role bait bait Region 26-33 Region 26-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 134-142 Region 134-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false entb-cd28-1 3230590 N/A 3230597 unspecified role unspecified role prey prey Extracellular domain Region 19-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Fc-tag Fc-tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse Mus musculus Mouse N/A 3230598 unspecified role unspecified role bait bait Mature protein Region 28-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd28-entb-1 3230591 N/A 3230597 unspecified role unspecified role bait bait Extracellular domain Region 19-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3230598 unspecified role unspecified role prey prey Mature protein Region 28-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false entb-cd28-2 3230592 N/A 3230597 unspecified role unspecified role prey prey Extracellular domain Region 19-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3230598 unspecified role unspecified role bait bait Region 177-188 Region 177-188 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P01552:p.Lys179Ala K179A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false entb-cd28-3 3230593 N/A 3230597 unspecified role unspecified role prey prey Extracellular domain Region 19-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3230598 unspecified role unspecified role bait bait Mature protein Region 28-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd28-entb-2 3230594 N/A 3230597 unspecified role unspecified role bait bait Region 26-33 Region 26-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 134-142 Region 134-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3230598 unspecified role unspecified role prey prey Mature protein Region 28-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd28-cd86-1 3230595 N/A 3230599 unspecified role unspecified role prey prey Extracellular domain Region 20-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3230597 unspecified role unspecified role bait bait Extracellular domain Region 19-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse direct interaction direct interaction false false false