DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mariappan-2011-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218930X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218921X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-3 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218925X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218934X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218926X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218931X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218922X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-8 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218935X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-9 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218938X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-10 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218927X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-11 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218923X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-12 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218932X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-13 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218936X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-14 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218928X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-15 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218924X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-16 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218937X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-17 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218929X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mariappan-2011-18 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. DIP original experiment: DIP-218933X Nature 2011 IMEx The mechanism of membrane-associated steps in tail-anchored protein insertion. Mariappan M., Mateja A., Dobosz M., Bove E., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 get1_yeast Golgi to ER traffic protein 1 YGL020C GET1 Guided entry of tail-anchored proteins 1 MDM39 Mitochondrial distribution and morphology protein 39 protein protein yeast Saccharomyces cerevisiae Baker's yeast MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYGKTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIMEGKFGASKFDDMALQSVSLGIWVWALMNVINGVEFIVKQLFLTPKMEAPASVETQEEKALDAVDDAIILD C43DC5928D97DB7D sc61b_human Protein transport protein Sec61 subunit beta SEC61B protein protein human Homo sapiens Human MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS get2_yeast Golgi to ER traffic protein 2 GET2 HUR2 Required for meiotic nuclear division protein 7 Hydroxyurea resistance protein 2 RMD7 YER083C Guided entry of tail-anchored proteins 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELTEAEKRRLLRERRQKKFSNGGASSRLNKITGQASSHLNAESPLDAPSAAKTTPPASVHSATPDIKEDSNVAPQLDLLKQLAAMQGQGTGKSTPQDSSTPDLLSLLSSMNTGMPSAEGTPSFGQAAPAAPINQAALDYHDYLLNRLKAWTILVKWVFFLLPYLYLITRPNSSVWPAYAFTQSAWFAPLRNPSNFTRIFATFEFLSISIYYQLLKNVEHKSKIKNLQDTNKLVKLVSLVPEGVIPVANLKGKLITLLQYWDLLSMLITDISFVLIVLGLLTYL 1667E7C879CFB6EA get1-get3-4 3229660 N/A 3229678 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3229679 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P53192:p.Arg73Glu R73E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sec61b-get3-1 3229661 N/A 3229678 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3229680 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false get2-get3-1 3229662 N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3229681 unspecified role unspecified role unspecified role unspecified role Region 1-106 Region 1-106 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false get2-get3-2 3229663 N/A 3229678 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3229681 unspecified role unspecified role bait bait Region 1-38 Region 1-38 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false get1-get3-5 3229664 N/A 3229679 unspecified role unspecified role unspecified role unspecified role Region 21-104 Region 21-104 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P53192:p.Arg73Glu R73E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get1-get3-6 3229665 N/A 3229679 unspecified role unspecified role bait bait Region 21-104 Region 21-104 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3229678 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false get1-get2-5 3229666 N/A 3229678 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3229681 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3229679 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false get3-get2-3 3229667 N/A 3229678 unspecified role unspecified role fluorescence donor fluorescence donor Alexa488-label Alexa488-label alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3229681 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Region 1-106 Region 1-106 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Alexa594-label Alexa594-label alexa 594 label alexa 594 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false get3-sec61b-1 3229668 N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3229680 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false get1-get3-7 3229669 N/A 3229679 unspecified role unspecified role unspecified role unspecified role Region 21-104 Region 21-104 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get1-get2-6 3229670 N/A 3229681 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3229679 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false get1-get3-8 3229671 N/A 3229679 unspecified role unspecified role unspecified role unspecified role Region 21-104 Region 21-104 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-get1-1 3229672 N/A 3229679 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Region 21-104 Region 21-104 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Alexa594-label Alexa594-label alexa 594 label alexa 594 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3229678 unspecified role unspecified role fluorescence donor fluorescence donor Alexa488-label Alexa488-label alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false get1-get3-9 3229673 N/A 3229679 unspecified role unspecified role unspecified role unspecified role Region 21-104 Region 21-104 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get2-get3-3 3229674 N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3229681 unspecified role unspecified role unspecified role unspecified role Region 1-106 Region 1-106 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P40056:p.Arg17Glu R17E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false get3-sec61b-2 3229675 N/A 3229678 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3229680 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false get2-get3-4 3229676 N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3229681 unspecified role unspecified role unspecified role unspecified role Region 1-38 Region 1-38 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false get2-get3-5 3229677 N/A 3229678 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3229681 unspecified role unspecified role unspecified role unspecified role Region 1-38 Region 1-38 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false