DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yoon-2011-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218684X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218682X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218687X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-5 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218689X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-6 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218692X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-7 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218683X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-8 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218685X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-9 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218693X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-10 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218690X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-11 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218691X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-12 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218686X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation yoon-2011-13 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218688X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Yoon SI., Hong M., Wilson IA. Only protein-protein interactions imex curation ly86_mouse Lymphocyte antigen 86 Ly86 Md1 Protein MD-1 protein protein mouse Mus musculus Mouse MNGVAAALLVWILTSPSSSDHGSENGWPKHTACNSGGLEVVYQSCDPLQDFGLSIDQCSKQIQSNLNIRFGIILRQDIRKLFLDITLMAKGSSILNYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENRATVACANATVTSS cd180_mouse CD180 antigen Cd180 Rp105 Ly78 Lymphocyte antigen 78 Radioprotective 105 kDa protein protein protein mouse Mus musculus Mouse MAPDISCFFLVALFLASCRATTSSDQKCIEKEVNKTYNCENLGLNEIPGTLPNSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPLIFMAETALSGPKALKHLFFIQTGISSIDFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAGIELGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNRLTSSSIEALSHLKGIYLNLASNRISIILPSLLPILSQQRTINLRQNPLDCTCSNIYFLEWYKENMQKLEDTEDTLCENPPLLRGVRLSDVTLSCSMAAVGIFFLIVFLLVFAILLIFAVKYFLRWKYQHI a4ift3_bovin LY86 protein protein bovin Bos taurus (Bovine) Bovine MKGFAAALLIWTLLSPRRAGGEAWPTHTACRNGNLQVLYQSCDPLQDFGFSVDQCARQLKPNINIRFGMVLREDIEQLFLDVALFSKGLSILNFSYPVCEVDLPKFSFCGRRKGEQIYYAGPINNPGFEIPEGDYQVLLELYNQDHATVACANATVLYS q0v8g5_bovin CD180 protein protein bovin Bos taurus (Bovine) Bovine MAPCVSCFLLAVLISAGCKAIPSSDPKCTEKEGNRTYNCENLGLREIPDTLPNTTEVLEFSFNFLPTIQNTTFSRLINLIFLDLTRCQINWVHEDTFQSHHQLNTIVLTGNPLIFMAETSLTGPKFLKHLFLTQTGISNLKFIPVHNLENLESLHLGSNHISSINLPENFPTQNLKVLDFQNNAIHYISRKDTNSLEQATNLSLNFNGNDIKGIEPGAFSSKIFQSLKFGGSLNLFIIFKGLQNSTLQSLWLGTFEDTDDQYLTSATFEGLCDMSVESINLQKHRFSDLSSSTFQCFTRVQELDLTAAHLNGLPSGIEGMNSLKKLVLNANSFDQLCQINAASFPSLRDLYIKGNMRKLDLGTRCLEKLENLQKLDLSHSDIEASDCCNLQLKNLRHLQYLNLSYNEPLGLEDQAFKECPQLELLDVAFTHLHVKAPHSPFQNLHLLRVLNLSHCLLDTSNQHLLAGLQDLRHLNLQGNSFQDGSISKTNLLQMVGSLEILILSSCNLLSIDQQAFHGLRNVNHLDLSHNSLTGDSMDTLSHLKGLYLNMASNNIRIIPPHLLPALSQQSIINLSNNPLDCTCSNIHFITWYKENLHKLEDSEETTCANPPSLRGVKLSDVKLHCGITGVGIFFIVVFVFLLILLLIFSVKFILRWKYQHI ly86_human Lymphocyte antigen 86 LY86 MD1 Protein MD-1 protein protein human Homo sapiens Human MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS cd180_human CD180 antigen CD180 LY64 RP105 Lymphocyte antigen 64 Radioprotective 105 kDa protein protein protein human Homo sapiens Human MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEFSFNFLPTIHNRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETSLNGPKSLKHLFLIQTGISNLEFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTIFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLHLGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECPQLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNHFQDGTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIISPRLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLEGSEETTCANPPSLRGVKLSDVKLSCGITAIGIFFLIVFLLLLAILLFFAVKYLLRWKYQHI ly96_mouse Lymphocyte antigen 96 Protein MD-2 ESOP-1 Ly96 Esop1 Md2 protein protein mouse Mus musculus Mouse MLPFILFSTLLSPILTESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN tlr4_mouse Toll-like receptor 4 Tlr4 Lps protein protein mouse Mus musculus Mouse MMPPWLLARTLIMALFFSCLTPGSLNPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQKFLQWVKEQKQFLVNVEQMTCATPVEMNTSLVLDFNNSTCYMYKTIISVSVVSVIVVSTVAFLIYHFYFHLILIAGCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFHLCLHYRDFIPGVAIAANIIQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQVELYRLLSRNTYLEWEDNPLGRHIFWRRLKNALLDGKASNPEQTAEEEQETATWT cd180-ly86-1 3229395 N/A 3229407 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3229408 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false cd180-ly86-2 3229396 N/A 3229409 unspecified role unspecified role unspecified role unspecified role Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229410 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false cd180-ly86-3 3229397 N/A 3229407 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229408 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ly86-cd180-1 3229398 N/A 3229407 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229408 unspecified role unspecified role prey prey Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false cd180-ly86-4 3229399 N/A 3229411 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229412 unspecified role unspecified role bait bait Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false cd180-ly86-5 3229400 N/A 3229409 unspecified role unspecified role unspecified role unspecified role Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229410 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false cd180-ly86-6 3229401 N/A 3229411 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229412 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ly86-cd180-2 3229402 N/A 3229411 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229412 unspecified role unspecified role prey prey Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false cd180-ly86-7 3229403 N/A 3229409 unspecified role unspecified role prey prey Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229410 unspecified role unspecified role bait bait Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false ly86-cd180-3 3229404 N/A 3229409 unspecified role unspecified role bait bait Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229410 unspecified role unspecified role prey prey Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false ly96-tlr4-10 3229405 N/A 3229413 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229414 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 26-638 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false cd180-ly86-8 3229406 N/A 3229407 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3229408 unspecified role unspecified role bait bait Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false