DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ guan-2011-1 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. DIP original experiment: DIP-249679X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus. Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. Only protein-protein interactions imex curation guan-2011-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. DIP original experiment: DIP-249677X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus. Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. Only protein-protein interactions imex curation guan-2011-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. DIP original experiment: DIP-249680X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus. Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. Only protein-protein interactions imex curation guan-2011-4 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. DIP original experiment: DIP-249678X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus. Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. Only protein-protein interactions imex curation guan-2011-5 human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. DIP original experiment: DIP-249681X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus. Guan R., Ma LC., Leonard PG., Amer BR., Sridharan H., Zhao C., Krug RM., Montelione GT. Only protein-protein interactions imex curation ns1_inble Non-structural protein 1 NS1A NS protein protein inble inble MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYCVKNPSTSKCPNYDWTDYPPTPGKYLDDIEEEPENVDHPIEVVLRDMNNKDARQKIKDEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGDKSLSTLHRLNAYDQNGGLVAKLVATDDRTVEDEKDGHRILNSLFERFDEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN 09C376EA400CA73F isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS ns1b-1 3229030 N/A 3229035 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false isg15-ns1b-1 3229031 N/A 3229036 unspecified role unspecified role unspecified role unspecified role Mature protein Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229035 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false isg15-ns1b-2 3229032 N/A 3229036 unspecified role unspecified role unspecified role unspecified role Mature protein Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229035 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false isg15-ns1b-3 3229033 N/A 3229036 unspecified role unspecified role unspecified role unspecified role Mature protein Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3229035 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false isg15-ns1b-4 3229034 N/A 3229036 unspecified role unspecified role bait bait Mature protein Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3229035 unspecified role unspecified role prey prey P03502:p.[Trp36Ala;Gln37Ala] W36A/Q37A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P03502:p.[Met91Ala;Phe100Ala] M91A/F100A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false