DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ carter-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. DIP original experiment: DIP-253898X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Iron-containing urease in a pathogenic bacterium. Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. Only protein-protein interactions imex curation carter-2011-2 helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. DIP original experiment: DIP-253901X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Iron-containing urease in a pathogenic bacterium. Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. Only protein-protein interactions imex curation carter-2011-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. DIP original experiment: DIP-253899X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Iron-containing urease in a pathogenic bacterium. Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. Only protein-protein interactions imex curation carter-2011-4 helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. DIP original experiment: DIP-253900X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Iron-containing urease in a pathogenic bacterium. Carter EL., Tronrud DE., Taber SR., Karplus PA., Hausinger RP. Only protein-protein interactions imex curation d3uj80_helm1 Urease subunit beta ureB Urea amidohydrolase subunit beta ureB2 HMU13010 protein protein helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae MKMKRQEYVNTYGPTTGDKVRLGDTDLWAEVEHDYTVYGEELKFGAGKTIREGMGQSNSPDENTLDLVITNALIIDYTGIYKADIGIKNGKIHGIGKAGNKDMQDGVTPHMVVGVGTEALAGEGMIITAGGIDSHTHFLSPQQFPTALANGVTTMFGGGTGPVDGTNATTITPGVWNLHRMLRAAEEYGMNVGLLGKGNSSSRAQLVEQVKAGAIGFKLHEDWGTTPSAIDHCLSVADEYDVQVCIHTDTVNEAGYVDDTLRAMNGRAIHAYHIEGAGGGHSPDVITMAGEVNILPSSTTPTIPYTINTVAEHLDMLMTCHHLDKRIREDLQFSQSRIRPGSIAAEDTLHDMGVIAMTSSDSQAMGRAGEVIPRTWQTADKNKKEFGRLTEEKGDNDNFRIKRYISKYTINPAITHGVSEYIGSVEEGKIADLVVWNPAFFGVKPKIIIKGGMVVFSEMGDSNASVPTPQPVYYREMFGHHGKAKFDTSITFVSKVAYENGIKEKLGLERKVLPVKNCRNVTKKDFKFNNTTAKITVNPETFEVFVNGKLCTSKPATEVALASRYTFF d3uj81_helm1 Urease ureA2 HMU13020 protein protein helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae MKLTPKEQEKFLLYYAGEVARKRKEEGLKLNQPEAIAYISAHIMDEARRGKKTVAQLMEECVHFLKKDEVMPGVGNMVPDLGVEANFPDGTKLVTVNWPIEPDDFKAGEIKFASDKDIELNAGKEITELKVTNKGPKSLHVGSHFHFFEANRALEFDREKAYGKRLDIPSGNTLRIGAGETKTVHLIPIGGSKKIIGMNGLLNGIADDLHKQKALEKAKHHGFIK d3uge7_helm1 Urease subunit beta ureB Urea amidohydrolase subunit beta HMU03060 protein protein helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae MIKISRKEYVSMYGPTTGDKVRLGDTELIAEIEKDYTVYGEEIKFGGGKTIRDGMSQSVSPDVNELDAVITNAMIIDYTGIYKADIGIKDGKIAGIGKAGNRDTQDGVGMDLVVGASTEAIAGEGLIVTAGGIDTHIHFISPTQIPTALYSGVTTMIGGGTGPAAGTFATTISPGEWNIKQMIRAAEEYTMNLGFFGKGNTSNVKALEDQIKAGALGFKVHEDWGSTPAVINHSLNIAEKYDVQVAIHTDTLNEGGAVEDTLAAIGGRTIHTFHTEGAGGGHAPDIIKAAGEANILPASTNPTIPFTKNTKDEHLDMLMVCHHLDKNIKEDVAFADSRIRPETIAAEDALHDMGIFSITSSDSQAMGRVGEVITRTWQVADKSKKEFGRLKEETGDNDNFRIKRYVSKYTINPAIAHGISDYIGSVEKGKIADLVLWDPGLFGIKPETIIKGGMIVASKMGDSNASIPTPEPVVYKDMFGAHGKAKYKCNVTFVSQASLDLGIKEELGLERTLLPVKNCRNIGKRDMKFNDVVAHIDVNPETYKVKVNGKEVTSKSADSVPLSQLYNLF d3uge6_helm1 Urease subunit alpha ureA Urea amidohydrolase subunit alpha HMU03050 protein protein helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae MRLTPKELDKMMLHYAGELAKKRKERGVKLNYVEAVALISMEIMEHAREGKKTVADLMSLGRQVLKAEDVMDGVAALVHEVQIEVCFPDGTKLVTVHNPIENNGKLHPGEFILKDEDIVLNAGKEAIEVKVSNKGDRPIQVGSHFHFFETNKLLEFDREKAYGRRLDIASGTSVRFEPGESKTVRLIQFGGNQRIFGFNDLNNGQVNEDNKRKALAAAKAKGFIK urea2-ureb-1 3228858 N/A 3228862 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228863 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false urea-ureb-12 3228859 N/A 3228864 unspecified role unspecified role unspecified role unspecified role helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae N/A 3228865 unspecified role unspecified role unspecified role unspecified role helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae direct interaction direct interaction false false false urea2-ureb-2 3228860 N/A 3228862 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228863 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false urea2-ureb-3 3228861 N/A 3228862 unspecified role unspecified role unspecified role unspecified role helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae N/A 3228863 unspecified role unspecified role unspecified role unspecified role helm1 Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) Campylobacter mustelae direct interaction direct interaction false false false