DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ropars-2011-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253902X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions imex curation ropars-2011-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253905X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions imex curation ropars-2011-3 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253906X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions imex curation ropars-2011-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253903X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions imex curation ropars-2011-5 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253904X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions imex curation ropars-2011-6 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253907X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions imex curation q9h9q4-1 Non-homologous end-joining factor 1 NHEJ1 XLF Protein cernunnos XRCC4-like factor protein protein human Homo sapiens Human MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS xrcc4_human DNA repair protein XRCC4 X-ray repair cross-complementing protein 4 XRCC4 protein protein human Homo sapiens Human MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI nhej1-xrcc4-6 3228610 N/A 3228616 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228617 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nhej1-xrcc4-7 3228611 N/A 3228616 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228617 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false xrcc4-5 3228612 N/A 3228617 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nhej1-xrcc4-8 3228613 N/A 3228616 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228617 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q13426:p.Glu55Arg E55R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13426:p.Asp58Arg D58R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13426:p.Met61Arg M61R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13426:p.Phe106Glu F106E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13426:p.Lys65Glu K65E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13426:p.Phe106Tyr F106Y mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q13426:p.Phe106Ala F106A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nhej1-xrcc4-9 3228614 N/A 3228616 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228617 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false nhej1-1 3228615 N/A 3228616 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false