DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ batchelor-2011-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Batchelor JD., Zahm JA., Tolia NH. DIP original experiment: DIP-218647X Nature structural & molecular biology 2011 IMEx Dimerization of Plasmodium vivax DBP is induced upon receptor binding and drives recognition of DARC. Batchelor JD., Zahm JA., Tolia NH. Only protein-protein interactions imex curation batchelor-2011-2 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Batchelor JD., Zahm JA., Tolia NH. DIP original experiment: DIP-218645X Nature structural & molecular biology 2011 IMEx Dimerization of Plasmodium vivax DBP is induced upon receptor binding and drives recognition of DARC. Batchelor JD., Zahm JA., Tolia NH. Only protein-protein interactions imex curation batchelor-2011-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Batchelor JD., Zahm JA., Tolia NH. DIP original experiment: DIP-218648X Nature structural & molecular biology 2011 IMEx Dimerization of Plasmodium vivax DBP is induced upon receptor binding and drives recognition of DARC. Batchelor JD., Zahm JA., Tolia NH. Only protein-protein interactions imex curation batchelor-2011-4 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Batchelor JD., Zahm JA., Tolia NH. DIP original experiment: DIP-218646X Nature structural & molecular biology 2011 IMEx Dimerization of Plasmodium vivax DBP is induced upon receptor binding and drives recognition of DARC. Batchelor JD., Zahm JA., Tolia NH. Only protein-protein interactions imex curation batchelor-2011-5 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Batchelor JD., Zahm JA., Tolia NH. DIP original experiment: DIP-218649X Nature structural & molecular biology 2011 IMEx Dimerization of Plasmodium vivax DBP is induced upon receptor binding and drives recognition of DARC. Batchelor JD., Zahm JA., Tolia NH. Only protein-protein interactions imex curation q16570-1 Atypical chemokine receptor 1 ACKR1 DARC FY GPD Duffy antigen/chemokine receptor Fy glycoprotein Glycoprotein D Plasmodium vivax receptor protein protein human Homo sapiens Human MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS pvdr_plavs Duffy receptor PVDR Erythrocyte-binding protein protein protein Plasmodium vivax (strain Salvador I) Plasmodium vivax (strain Salvador I) MKGKNRSLFVLLVLLLLHKVNNVLLERTIETLLECKNEYVKGENGYKLAKGHHCVEEDNLERWLQGTNERRSEENIKYKYGVTELKIKYAQMNGKRSSRILKESIYGAHNFGGNSYMEGKDGGDKTGEEKDGEHKTDSKTDNGKGANNLVMLDYETSSNGQPAGTLDNVLEFVTGHEGNSRKNSSNGGNPYDIDHKKTISSAIINHAFLQNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVNNTDTNFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCSVEEAKKNTQEVVTNVDNAAKSQATNSNPISQPVDSSKAEKVPGDSTHGNVNSGQDSSTTGKAVTGDGQNGNQTPAESDVQRSDIAESVSAKNVDPQKSVSKRSDDTASVTGIAEAGKENLGASNSRPSESTVEANSPGDDTVNSASIPVVSGENPLVTPYNGLRHSKDNSDSDGPAESMANPDSNSKGETGKGQDNDMAKATKDSSNSSDGTSSATGDTTDAVDREINKGVPEDRDKTVGSKDGGGEDNSANKDAATVVGEDRIRENSAGGSTNDRSKNDTEKNGASTPDSKQSEDATALSKTESLESTESGDRTTNDTTNSLENKNGGKEKDLQKHDFKSNDTPNEEPNSDQTTDAEGHDRDSIKNDKAERRKHMNKDTFTKNTNSHHLNSNNNLSNGKLDIKEYKYRDVKATREDIILMSSVRKCNNNISLEYCNSVEDKISSNTCSREKSKNLCCSISDFCLNYFDVYSYEYLSCMKKEFEDPSYKCFTKGGFKDKTYFAAAGALLILLLLIASRKMIKNDSEEATFNEFEEYCDNIHRIPLMPNNIEHMQPSTPLDYS ackr1-pvdr-1 3228366 N/A 3228371 unspecified role unspecified role unspecified role unspecified role Region 1-60 Region 1-60 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228372 unspecified role unspecified role unspecified role unspecified role Region 211-525 Region 211-525 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ackr1-pvdr-2 3228367 N/A 3228371 unspecified role unspecified role unspecified role unspecified role Region 1-60 Region 1-60 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228372 unspecified role unspecified role unspecified role unspecified role Region 211-525 Region 211-525 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pvdr-1 3228368 N/A 3228372 unspecified role unspecified role unspecified role unspecified role Region 211-525 Region 211-525 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ackr1-pvdr-3 3228369 N/A 3228371 unspecified role unspecified role unspecified role unspecified role Region 1-60 Region 1-60 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228372 unspecified role unspecified role unspecified role unspecified role Region 211-525 Region 211-525 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pvdr-2 3228370 N/A 3228372 unspecified role unspecified role unspecified role unspecified role Region 211-525 Region 211-525 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false