DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhu-2011-14 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253927X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253913X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253908X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-17 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253918X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-18 allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253922X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253914X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-20 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253926X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253909X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-22 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253919X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-23 allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253923X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-24 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253910X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-25 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253920X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-26 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253915X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-27 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253911X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-28 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253924X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-29 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253916X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253917X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-31 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253912X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-32 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253925X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation zhu-2011-33 allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. DIP original experiment: DIP-253921X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis. Zhu Z., An F., Feng Y., Li P., Xue L., A M., Jiang Z., Kim JM., To TK., Li W., Zhang X., Yu Q., Dong Z., Chen WQ., Seki M., Zhou JM., Guo H. Only protein-protein interactions imex curation hda6_arath Histone deacetylase 6 HDA6 RPD3B MDC12.7 At5g63110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEADESGISLPSGPDGRKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLIIHYHLHRRLEISRPSLADASDIGRFHSPEYVDFLASVSPESMGDPSAARNLRRFNVGEDCPVFDGLFDFCRASAGGSIGAAVKLNRQDADIAINWGGGLHHAKKSEASGFCYVNDIVLGILELLKMFKRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIRDVGAEKGKYYALNVPLNDGMDDESFRSLFRPLIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFLRSYNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYFEYFGPDYTLHVDPSPMENLNTPKDMERIRNTLLEQLSGLIHAPSVQFQHTPPVNRVLDEPEDDMETRPKPRIWSGTATYESDSDDDDKPLHGYSCRGGATTDRDSTGEDEMDDDNPEPDVNPPSS ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI eil1_arath ETHYLENE INSENSITIVE 3-like 1 protein EIL1 At2g27050 T20P8.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMMFNEMGMYGNMDFFSSSTSLDVCPLPQAEQEPVVEDVDYTDDEMDVDELEKRMWRDKMRLKRLKEQQSKCKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQSENNISGGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGNEEWWPQLGLPNEQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVVARELYPESCPPLSSSSSLGSGSLLINDCSEYDVEGFEKEQHGFDVEERKPEIVMMHPLASFGVAKMQHFPIKEEVATTVNLEFTRKRKQNNDMNVMVMDRSAGYTCENGQCPHSKMNLGFQDRSSRDNHQMVCPYRDNRLAYGASKFHMGGMKLVVPQQPVQPIDLSGVGVPENGQKMITELMAMYDRNVQSNQTPPTLMENQSMVIDAKAAQNQQLNFNSGNQMFMQQGTNNGVNNRFQMVFDSTPFDMAAFDYRDDWQTGAMEGMGKQQQQQQQQQDVSIWF ein3_arath Protein ETHYLENE INSENSITIVE 3 EIN3 At3g20770 MOE17.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMFNEMGMCGNMDFFSSGSLGEVDFCPVPQAEPDSIVEDDYTDDEIDVDELERRMWRDKMRLKRLKEQDKGKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPAAITKYQAENNIPGIHEGNNPIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPESCPPLSLSGGSCSLLMNDCSQYDVEGFEKESHYEVEELKPEKVMNSSNFGMVAKMHDFPVKEEVPAGNSEFMRKRKPNRDLNTIMDRTVFTCENLGCAHSEISRGFLDRNSRDNHQLACPHRDSRLPYGAAPSRFHVNEVKPVVGFPQPRPVNSVAQPIDLTGIVPEDGQKMISELMSMYDRNVQSNQTSMVMENQSVSLLQPTVHNHQEHLQFPGNMVEGSFFEDLNIPNRANNNNSSNNQTFFQGNNNNNNVFKFDTADHNNFEAAHNNNNNSSGNRFQLVFDSTPFDMASFDYRDDMSMPGVVGTMDGMQQKQQDVSIWF ebf1_arath EIN3-binding F-box protein 1 EBF1 At2g25490 F-box/LRR-repeat protein 6 FBL6 F13B15.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKKPVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEIDVPSKITEDGDDCEGCLSRSLDGKKATDVRLAAIAVGTAGRGGLGKLSIRGSNSAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEGCAQLEKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT myc2_arath Transcription factor MYC2 MYC2 BHLH6 Basic helix-loop-helix protein 6 EN38 JAI1 JIN1 Protein JASMONATE INSENSITIVE 1 R-homologous Arabidopsis protein 1 RAP1 RD22BP1 Transcription factor EN 38 Z-box binding factor 1 protein ZBF1 bHLH transcription factor bHLH006 rd22BP1 F6N18.4 At1g32640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSSPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSSDLINKVRILFNFDGGAGDLSGLNWNLDPDQGENDPSMWINDPIGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSTSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSGQTQFENKRKRSMVLNEDKVLSFGDKTAGESDHSDLEASVVKEVAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT tify10a-hda6-1 3228102 N/A 3228122 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3228123 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false tify10a-eil1-1 3228103 N/A 3228124 unspecified role unspecified role prey prey Region 201-501 Region 201-501 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228123 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify10a-ein3-1 3228104 N/A 3228125 unspecified role unspecified role prey prey Region 300-500 Region 300-500 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 200-400 Region 200-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228123 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify10a-ein3-2 3228105 N/A 3228125 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3228123 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 160-253 Region 160-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ebf1-ein3-3 3228106 N/A 3228125 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false allce Allium cepa (Onion) Onion N/A 3228126 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false allce Allium cepa (Onion) Onion physical association physical association false false false tify6b-eil1-1 3228107 N/A 3228127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228124 unspecified role unspecified role prey prey Region 201-501 Region 201-501 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify10a-hda6-2 3228108 N/A 3228122 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3228123 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 1-190 Region 1-190 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false tify10a-myc2-5 3228109 N/A 3228128 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228123 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify6b-hda6-1 3228110 N/A 3228127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228122 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false ein3-tify10a-1 3228111 N/A 3228125 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false allce Allium cepa (Onion) Onion N/A 3228123 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false allce Allium cepa (Onion) Onion physical association physical association false false false tify10a-hda6-3 3228112 N/A 3228122 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228123 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify7-hda6-1 3228113 N/A 3228129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228122 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify7-eil1-1 3228114 N/A 3228129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228124 unspecified role unspecified role prey prey Region 201-501 Region 201-501 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false hda6-ein3-1 3228115 N/A 3228125 unspecified role unspecified role prey prey Region 200-400 Region 200-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228122 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify10a-ein3-3 3228116 N/A 3228125 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3228123 unspecified role unspecified role bait bait GUS-tag GUS-tag enzyme tag enzyme tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify6b-ein3-1 3228117 N/A 3228125 unspecified role unspecified role prey prey Region 200-500 Region 200-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false tify7-ein3-1 3228118 N/A 3228125 unspecified role unspecified role prey prey Region 200-500 Region 200-500 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false hda6-eil1-1 3228119 N/A 3228124 unspecified role unspecified role prey prey Region 201-501 Region 201-501 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3228122 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false ein3-hda6-1 3228120 N/A 3228125 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3228122 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false hda6-tify10a-1 3228121 N/A 3228122 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false allce Allium cepa (Onion) Onion N/A 3228123 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false allce Allium cepa (Onion) Onion physical association physical association false false false