DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wollmann-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218962X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218954X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-3 trini Trichoplusia ni (Cabbage looper) Cabbage looper dls dynamic light scattering dls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218956X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-4 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218959X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-5 trini Trichoplusia ni (Cabbage looper) Cabbage looper sls static light scattering sls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218957X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218955X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-7 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218960X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-8 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218958X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation wollmann-2011-9 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218961X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions imex curation q8st28_enccu ECU04_1440 protein protein enccu Encephalitozoon cuniculi (strain GB-M1) Microsporidian parasite MDAPDISYEHQETSVPNRSGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHRKA q8svz5_enccu ECU03_1530 protein protein enccu Encephalitozoon cuniculi (strain GB-M1) Microsporidian parasite MNRLEKFFTTLNTAQSKVLKGYTTDELVSQIKEYVDFTPYILKQTYRLLCGQASEDRRNGARILRSLMFQFKLVTDFKIEYKESSSIYLSSTGEQFNVQAPSIQEQKRMVRKIAKLEHVEANFLSDIDFKAGSGEAIKRHKVDERPIENVLDFFEQISDNLLSYEWYKRHGAFLAFAAMFSEIDNGGDIQIRVDSKLFSKIYEILVTDKFNDFVDDRTVAPVRDAAAYLLSRIYPLIGPNDIIEQLVGFLDSGDWQVQFSGLIALGYLKEFVEDKDGLCRKLVSLLSSPDEDIKLLSAELLCHFPITDSLDLVLEKCWKNIESEELISVSKTSNLSLLTKIYRENPELSIPPERLKDIFPCFTSPVPEVRTSILNMVKNLSEESIDFLVAEVVLIEEKDEIREMAIKLLKKRRDLPKNLILHFMNVIGGSLYEPYSEDDFVSYEDLYFTKSGINVVGKDEILKNRCLLFECIMKSGLPDLQSTIETTTSRTFISLYRSVQALVKDTPYTPANIEELEYYFDRCKDLKMAPLKEFKKKLSAPGIRSIHPMVDPLYSDYTRMVASIEFPGLERATALFEVETCKQFLHLFSKMITEYYDAEKISIDNFLLKAYEGLASGKDGFLSFFEVFNTRLLAHSFFHKIGSLENRLDFFSKTIHIYTKTSQIQKIGFVFDDALREKNITVINGFMRSLEFNEKFVRKALEDLDVELLDAVLMSGDHSFNPLFVKPLLRNISGNIDREASSKVLSKVIPTLGFSTNTKISKDLLEMIEREKKSLESLLDAGKIPEYHIKCPISVKLRDYQMEGVKWLNFLYSFSLNGILADDMGLGKTLQVLTFLCSEIYKTNRKVLVICPSSLTGHWKSEVKKFFPFVAAEIYKREDRDTYSILISSYETFRNDYLNFIEKDWFYVVVDEGHVLRNKQTILYSRMNMIRCSRKMVLTGTPVHNSVEDLISLFNFLMPNYIGPEKEYGSLNVKMSDSEIEKTHKRLDLLHRKVLPFILRRLKIDVLKDLPPKIIRDITVELGPVQEKLYREIDEKGGKESLGDAELEYGKVDQKNVGFKRTRDLFLAVSHIGHFKDSTEVSCKVKALEDIISLCGGEDLGSKILIFFQFKSTIDLVIKDIMKKYKFKYSRLDGSVPSAARTKIAEEFNTGTTQMLFLTTQVGGLGLNLTGADTVVMYEHDWNPFNDLQAMDRAHRIGQKRTVNVFRFIARNTLEEKVMNLQSFKMFVANSLVSQQNADIETMDTKDLLERFQVPG q8st28_enccu-1 3228060 N/A 3228069 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q8st28_enccu-q8svz5_enccu-1 3228061 N/A 3228069 unspecified role unspecified role unspecified role unspecified role Q8ST28:p.Lys103Glu K103E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3228070 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8svz5_enccu-1 3228062 N/A 3228070 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8st28_enccu-q8svz5_enccu-2 3228063 N/A 3228069 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228070 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8svz5_enccu-2 3228064 N/A 3228070 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8st28_enccu-q8svz5_enccu-3 3228065 N/A 3228069 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228070 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8st28_enccu-q8svz5_enccu-4 3228066 N/A 3228069 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228070 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8st28_enccu-q8svz5_enccu-5 3228067 N/A 3228069 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3228070 unspecified role unspecified role unspecified role unspecified role Region 1-1016 Region 1-1016 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false q8st28_enccu-2 3228068 N/A 3228069 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false