DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kosloff-2011-1 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218612X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-2 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218614X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-3 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218616X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-4 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218620X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-5 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218613X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-6 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218619X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-7 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218617X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218621X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-9 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218615X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation kosloff-2011-10 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218618X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions imex curation gnao_rat Guanine nucleotide-binding protein G(o) subunit alpha Gnao1 Gna0 Gnao protein protein rat Rattus norvegicus (Rat) Rat MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKADSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY mint Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear homomint rgs1_human Regulator of G-protein signaling 1 Early response protein 1R20 B-cell activation protein BL34 RGS1 1R20 BL34 IER1 protein protein human Homo sapiens Human MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK rgs7_human Regulator of G-protein signaling 7 RGS7 protein protein human Homo sapiens Human MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRASTNLL rgs10_human Regulator of G-protein signaling 10 RGS10 protein protein human Homo sapiens Human MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT rgs18_human Regulator of G-protein signaling 18 RGS18 RGS13 protein protein human Homo sapiens Human METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL rgs4_human Regulator of G-protein signaling 4 RGS4 protein protein human Homo sapiens Human MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA rgs17_human Regulator of G-protein signaling 17 RGS17 RGSZ2 protein protein human Homo sapiens Human MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES rgs14_human Regulator of G-protein signaling 14 RGS14 protein protein human Homo sapiens Human MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL rgs8_human Regulator of G-protein signaling 8 RGS8 protein protein human Homo sapiens Human MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS rgs16_human Regulator of G-protein signaling 16 RGS16 RGSR A28-RGS14P Retinal-specific RGS Retinally abundant regulator of G-protein signaling protein protein human Homo sapiens Human MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT gnao1-rgs1-1 3227662 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227673 unspecified role unspecified role unspecified role unspecified role RGS domain Region 85-200 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs7-1 3227663 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227674 unspecified role unspecified role unspecified role unspecified role RGS domain Region 333-448 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs10-1 3227664 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227675 unspecified role unspecified role unspecified role unspecified role RGS domain Region 33-148 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs18-1 3227665 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227676 unspecified role unspecified role unspecified role unspecified role RGS domain Region 86-202 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg;Gln186Lys] K141E/H156E/K158R/Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.Gln186Lys Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg] K141E/H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.[His156Glu;Lys158Arg] H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs4-1 3227666 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227677 unspecified role unspecified role unspecified role unspecified role RGS domain Region 62-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P49798:p.Asn128Ser N128S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P49798:p.[Glu126Ala;Arg134Ala;Arg166Ala] E126A/R134A/R166A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P49798:p.Arg134Ala R134A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P49798:p.[Arg134Ala;Arg166Ala] R134A/R166A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs17-1 3227667 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227678 unspecified role unspecified role unspecified role unspecified role RGS domain Region 84-200 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9UGC6:p.[Ile143Ser;Leu144Glu;Ser145Ala;Ser150Asn;His183Glu;Arg184Lys;Asn192Lys] I143S/L144E/S145A/S150N/H183E/R184K/N192K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9UGC6:p.[Ile143Ser;Leu144Glu;Ser145Ala;Ser150Asn;Asn192Lys] I143S/L144E/S145A/S150N/N192K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs14-1 3227668 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227679 unspecified role unspecified role unspecified role unspecified role RGS domain Region 67-184 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs18-2 3227669 N/A 3227672 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3227676 unspecified role unspecified role prey prey Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg;Gln186Lys] K141E/H156E/K158R/Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.Gln186Lys Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg] K141E/H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NS28:p.[His156Glu;Lys158Arg] H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs8-1 3227670 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227680 unspecified role unspecified role unspecified role unspecified role RGS domain Region 56-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gnao1-rgs16-3 3227671 N/A 3227672 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3227681 unspecified role unspecified role unspecified role unspecified role RGS domain Region 65-181 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O15492:p.Glu90Ala E90A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O15492:p.[Glu125Ala;Glu129Ala;Lys173Ala] E125A/E129A/K173A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O15492:p.[Glu125Ala;Glu129Ala] E125A/E129A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O15492:p.Glu129Ala E129A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false