DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ baughman-2011-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. DIP original experiment: DIP-254450X Nature 2011 IMEx Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter. Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. Only protein-protein interactions imex curation baughman-2011-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. DIP original experiment: DIP-254448X Nature 2011 IMEx Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter. Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. Only protein-protein interactions imex curation baughman-2011-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. DIP original experiment: DIP-254451X Nature 2011 IMEx Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter. Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. Only protein-protein interactions imex curation baughman-2011-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. DIP original experiment: DIP-254449X Nature 2011 IMEx Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter. Baughman JM., Perocchi F., Girgis HS., Plovanich M., Belcher-Timme CA., Sancak Y., Bao XR., Strittmatter L., Goldberger O., Bogorad RL., Koteliansky V., Mootha VK. Only protein-protein interactions imex curation micu1_human Calcium uptake protein 1, mitochondrial MICU1 Calcium-binding atopy-related autoantigen 1 CBARA1 CALC Atopy-related autoantigen CALC protein protein human Homo sapiens Human MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESPPCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ q8ne86-1 Calcium uniporter protein, mitochondrial MCU C10orf42 CCDC109A Coiled-coil domain-containing protein 109A protein protein human Homo sapiens Human MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD q9bpx6-1 Calcium uptake protein 1, mitochondrial MICU1 CALC CBARA1 Atopy-related autoantigen CALC Calcium-binding atopy-related autoantigen 1 protein protein human Homo sapiens Human MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESPPCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ mcu-micu1-1 3227636 N/A 3227640 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3227641 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false mcu-micu1-2 3227637 N/A 3227641 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3227642 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false mcu-mcu-1 3227638 N/A 3227641 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3227641 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false micu1-mcu-1 3227639 N/A 3227641 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3227642 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false