DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ keenholtz-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Keenholtz RA., Rowland SJ., Boocock MR., Stark WM., Rice PA. DIP original experiment: DIP-218827X Structure (London, England : 1993) 2011 IMEx Structural basis for catalytic activation of a serine recombinase. Keenholtz RA., Rowland SJ., Boocock MR., Stark WM., Rice PA. Only protein-protein interactions imex curation bin3_staau Putative transposon Tn552 DNA-invertase bin3 bin3 protein protein staau Staphylococcus aureus MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNGLS bin3-1 3227143 N/A 3227144 unspecified role unspecified role unspecified role unspecified role Catalytic domain Region 1-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false