DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ swanson-2011-1 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Swanson KA., Settembre EC., Shaw CA., Dey AK., Rappuoli R., Mandl CW., Dormitzer PR., Carfi A. DIP original experiment: DIP-249570X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for immunization with postfusion respiratory syncytial virus fusion F glycoprotein (RSV F) to elicit high neutralizing antibody titers. Swanson KA., Settembre EC., Shaw CA., Dey AK., Rappuoli R., Mandl CW., Dormitzer PR., Carfi A. Only protein-protein interactions imex curation swanson-2011-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Swanson KA., Settembre EC., Shaw CA., Dey AK., Rappuoli R., Mandl CW., Dormitzer PR., Carfi A. DIP original experiment: DIP-249571X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural basis for immunization with postfusion respiratory syncytial virus fusion F glycoprotein (RSV F) to elicit high neutralizing antibody titers. Swanson KA., Settembre EC., Shaw CA., Dey AK., Rappuoli R., Mandl CW., Dormitzer PR., Carfi A. Only protein-protein interactions imex curation fus_hrsva Fusion glycoprotein F0 F protein protein hrsva human respiratory sy MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN f-3 3226440 N/A 3226442 unspecified role unspecified role unspecified role unspecified role Region 1-136/146-524 Region 1-136/146-524 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false f-4 3226441 N/A 3226442 unspecified role unspecified role unspecified role unspecified role Region 1-136/146-524 Region 1-136/146-524 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false