IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ delahaye-2011-1 human-nkl Homo sapiens nkl nkl anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Delahaye NF., Rusakiewicz S., Martins I., Ménard C., Roux S., Lyonnet L., Paul P., Sarabi M., Chaput N., Semeraro M., Minard-Colin V., Poirier-Colame V., Chaba K., Flament C., Baud V., Authier H., Kerdine-Römer S., Pallardy M., Cremer I., Peaudecerf L., Rocha B., Valteau-Couanet D., Gutierrez JC., Nunès JA., Commo F., Bonvalot S., Ibrahim N., Terrier P., Opolon P., Bottino C., Moretta A., Tavernier J., Rihet P., Coindre JM., Blay JY., Isambert N., Emile JF., Vivier E., Lecesne A., Kroemer G., Zitvogel L. zitvogel@igr.fr,kroemer@orange.fr Nature medicine 2011 imex curation Only protein-protein interactions cd3z_human T-cell surface glycoprotein CD3 zeta chain T-cell receptor T3 zeta chain CD247 CD3Z T3Z TCRZ protein protein human Homo sapiens Human MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR o14931-1 Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein 1C7a protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG o14931-2 Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein 1C7c protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCHCHMGTHCHSSDGPRGVIPEPRCP o14931-3 Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein 1C7b protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKYAKSTLSGFPQL ncr3a-cd247-1 2969727 N/A 2969728 unspecified role unspecified role prey prey N/A 2969729 unspecified role unspecified role bait bait physical association physical association false false false 3A-1 ncr3c-cd247-1 2969727 N/A 2969728 unspecified role unspecified role prey prey N/A 2969730 unspecified role unspecified role bait bait physical association physical association false false false 3A-2 ncr3b-cd247-1 2969727 N/A 2969728 unspecified role unspecified role prey prey N/A 2969731 unspecified role unspecified role bait bait physical association physical association false false false 3A-3