DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mller-2011-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216778X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216770X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216781X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216779X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216771X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216775X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216782X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216772X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216776X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216780X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216773X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-12 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216774X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation mller-2011-13 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. DIP original experiment: DIP-216777X PLoS biology 2011 IMEx A cytoplasmic complex mediates specific mRNA recognition and localization in yeast. Müller M., Heym RG., Mayer A., Kramer K., Schmid M., Cramer P., Urlaub H., Jansen RP., Niessing D. Only protein-protein interactions imex curation she3_yeast SWI5-dependent HO expression protein 3 YBR1005 YBR130C SHE3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDQDNTQTSSSKLAPHHNIFMANLESSPTKDRNTSSQNASSSRVIESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLNLLKNENENLNSIFERKNKKLKELEKDYSELSNRYNEQKEKMDQLSKLAKNSSAIEQSCSEKLQNMEVNYNSLLESQNLYRDHYSDEISKLNEKIGLLELELSNQNLNYGSDTSSNSDIELNLNKFNDSVKDLKSLETEKDSKLSKIITHSLDELNLQSWLNLYQTNENLISTFAEKMDLKDVLKRNDEKISNKGAVVQTLKKNVQTQVESNNADALSSNNAQDMLPIKMVKLRKTPNTNDSSSNGNSSNNKRRSFYTASPLLSSGSIPKSASPVLPGVKRTASVRKPSSSSSKTNVTHNNDPSTSPTISVPPGVTRTVSSTHKKKGNSMVVHGAQS 590404D2E140BB7A she2_yeast SWI5-dependent HO expression protein 2 YKL130C SHE2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKDKDIKVTPGTCELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDCVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKCVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKCADEDGTNIGETDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGKLKN 5514B374655EFDBB puf6_yeast Pumilio homology domain family member 6 PUF6 D9719.2 YDR496C protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPLTKKTNGKRSAKEVSHSEKKLAKKPRISIDSSDEESELSKKEDAVSSSSDDDDLDDLSTSDSEAEEEADELDISDDSEEHENENEEKEGKDKSEGGENGNHTEQRKLLKERKMQRKSGTQVQQIKSVWERLRVKTPPLPKQIREKLSNEIWELSKDCISDLVLKHDASRIVQTLVKYSSKDRREQIVDALKGKFYVLATSAYGKYLLVKLLHYGSRSSRQTIINELHGSLRKLMRHREGAYVVEDLFVLYATHEQRQQMIKEFWGSEYAVFRETHKDLTIEKVCESSIEKRNIIARNLIGTITASVEKGSTGFQILHAAMREYVKIANEKEISEMIELLHEQFAELVHTPEGSDVACTLVARANAKERKLILKALKNHAEKLIKNEYGNIVFITILNCVDDTVLVFKTFSPTVKEHLQEFIIDKFGRRPWLYILLGLDGKYFSPIVKNELLRYIELSKATSKKDPLQRRHELLSKFAPMFLSTISKDYSSILTENLGCQFIAEVLINDELYAQLNEKDQEKYQQVLNNILTTFKGDITEEEHPIHRAFSTRLLKALIQGGKWNNKEKKVIPLKNVQGLGVPFAEKLYDEIIDSSNLLEWINNADSSFTIVALYETLKDQKEGKPFLKDLRGVQSKITTDESNKGSQLLAKLLK 4D172E8854326ECF myo4_yeast Myosin-4 MYO4 SHE1 YAL029C FUN22 SWI5-dependent HO expression protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLEMLNDSYTRLTQLLQGDLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTLNKKNALKERKKKQSSLIQSHMQSLAAIKGNKPSRLSDEVKSMKQELAFIENVIAQDFTTTYSANKNDKVKGLGIAGQQVKPKLVNVIRRESGNPDLLELLMDLNCYTLEVTEGYLKKVNVTEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFAANQKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVLNEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPRIEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRENLSLPGKMEIMLSAQFDSAKNHLRYDTSAITQNSNTEGLATVSKIIKLDRK E79C0FE72B041E95 she2p-she3p-1 3225467 N/A 3225480 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminal domain Region 334-425 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225481 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false she3p-she2p-1 3225468 N/A 3225480 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P38272:p.[Leu364Ala;Val367Ala] L364A/V367A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225481 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false she2p-she3p-2 3225469 N/A 3225480 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225481 unspecified role unspecified role unspecified role unspecified role region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false she3p-she2p-2 3225470 N/A 3225480 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225481 unspecified role unspecified role prey prey P36068:p.[Phe195Ala;Leu196Ala] F195A/L196A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P36068:p.[Gln197Ala;Glu198Ala;Ile199Ala] Q197A/E198A/I199A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false she3p-she2p-3 3225471 N/A 3225480 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225481 unspecified role unspecified role prey prey region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false puf6p-she2p-1 3225472 N/A 3225480 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225482 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225481 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false she2p-1 3225473 N/A 3225481 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 141-146 decreased the interaction rate/strength. puf6p-she2p-2 3225474 N/A 3225482 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225481 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false she3p-puf6p-1 3225475 N/A 3225480 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225482 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225481 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false she2p-she3p-3 3225476 N/A 3225480 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3225481 unspecified role unspecified role bait bait region Δ164-179 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region Δ141-146 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false she2p-she3p-4 3225477 N/A 3225480 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225481 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false myo4p-she2p-1 3225478 N/A 3225483 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 923-1471 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225480 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3225481 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false she3p-she2p-4 3225479 N/A 3225480 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminal domain Region 334-425 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225481 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false