DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ghai-2011-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. DIP original experiment: DIP-253646X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. Only protein-protein interactions imex curation ghai-2011-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. DIP original experiment: DIP-253651X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. Only protein-protein interactions imex curation ghai-2011-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. DIP original experiment: DIP-253649X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. Only protein-protein interactions imex curation ghai-2011-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. DIP original experiment: DIP-253647X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. Only protein-protein interactions imex curation ghai-2011-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. DIP original experiment: DIP-253650X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. Only protein-protein interactions imex curation ghai-2011-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. DIP original experiment: DIP-253648X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Phox homology band 4.1/ezrin/radixin/moesin-like proteins function as molecular scaffolds that interact with cargo receptors and Ras GTPases. Ghai R., Mobli M., Norwood SJ., Bugarcic A., Teasdale RD., King GF., Collins BM. Only protein-protein interactions imex curation app Amyloid precursor peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) CKQNGYENPTYKFFE snx17_human Sorting nexin-17 SNX17 KIAA0064 protein protein human Homo sapiens Human MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPPKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS q3uhd6-2 Sorting nexin-27 Snx27 Kiaa0488 SNX27b protein protein mouse Mus musculus Mouse MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTIRKWLFTTEEEVLLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLHEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY q6p8y7-2 Sorting nexin-31 Snx31 protein protein mouse Mus musculus Mouse MKMHFCIPVSQQRPDALGGRYVLYSVYLDGFLFCKVRYSQLHRWDEQLRRVFGNCLPPFPPKYYLAMTTAMAEERRDQLERYLQNVTADPRVTRSDVFTEFLTLVQLHTLNITIQNVELAVFLPDGRSIKVEGLTSDTAERVLEVMAHKLGLQPDLVGYFGLFLIQCFPEGKLSVVKKLADFELPYTSLQSSEMENCKIGLRKWYLDPALDSMLMDCRAAGDLLYMQAVQDIEKEWMKPTQAQREELKALQKKENQTKFLELSQEVRHYGYVQLDPCTCNHPEPGCGAQLSIGNNEISCCITLPNGQIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQWFVIYTKQAFFLSSCLKKMISERMTKLTEQSPEMQIEVPEQGRSKKHPSQPSQKVYFNFLRKGKMKRSEGDYVWDTLMEEGL No experimental confirmation available. app-snx17-1 3225273 N/A 3225279 unspecified role unspecified role unspecified role unspecified role app:p.Tyr11Ala Y11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3225280 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false snx17-hras-1 3225274 N/A 3225280 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false FERM domain Region 109-388 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225281 unspecified role unspecified role prey prey Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snx27-hras-1 3225275 N/A 3225281 unspecified role unspecified role prey prey Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli n/a 3225282 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 156-526 Region 156-526 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false app-snx27-1 3225276 N/A 3225282 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225279 unspecified role unspecified role unspecified role unspecified role app:p.Tyr11Ala Y11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false snx31-hras-1 3225277 n/a 3225283 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225281 unspecified role unspecified role prey prey Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false app-snx27-2 3225278 N/A 3225282 unspecified role unspecified role unspecified role unspecified role FERM domain Region 271-526 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3225279 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction false false false