DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ geng-2011-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Geng Y., Dong Y., Yu M., Zhang L., Yan X., Sun J., Qiao L., Geng H., Nakajima M., Furuichi T., Ikegawa S., Gao X., Chen YG., Jiang D., Ning W. DIP original experiment: DIP-253488X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Follistatin-like 1 (Fstl1) is a bone morphogenetic protein (BMP) 4 signaling antagonist in controlling mouse lung development. Geng Y., Dong Y., Yu M., Zhang L., Yan X., Sun J., Qiao L., Geng H., Nakajima M., Furuichi T., Ikegawa S., Gao X., Chen YG., Jiang D., Ning W. Only protein-protein interactions imex curation geng-2011-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Geng Y., Dong Y., Yu M., Zhang L., Yan X., Sun J., Qiao L., Geng H., Nakajima M., Furuichi T., Ikegawa S., Gao X., Chen YG., Jiang D., Ning W. DIP original experiment: DIP-253490X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Follistatin-like 1 (Fstl1) is a bone morphogenetic protein (BMP) 4 signaling antagonist in controlling mouse lung development. Geng Y., Dong Y., Yu M., Zhang L., Yan X., Sun J., Qiao L., Geng H., Nakajima M., Furuichi T., Ikegawa S., Gao X., Chen YG., Jiang D., Ning W. Only protein-protein interactions imex curation geng-2011-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Geng Y., Dong Y., Yu M., Zhang L., Yan X., Sun J., Qiao L., Geng H., Nakajima M., Furuichi T., Ikegawa S., Gao X., Chen YG., Jiang D., Ning W. DIP original experiment: DIP-253489X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Follistatin-like 1 (Fstl1) is a bone morphogenetic protein (BMP) 4 signaling antagonist in controlling mouse lung development. Geng Y., Dong Y., Yu M., Zhang L., Yan X., Sun J., Qiao L., Geng H., Nakajima M., Furuichi T., Ikegawa S., Gao X., Chen YG., Jiang D., Ning W. Only protein-protein interactions imex curation bmpr2_human Bone morphogenetic protein receptor type-2 Bone morphogenetic protein receptor type II PPH1 BMPR2 protein protein human Homo sapiens Human MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGESTQDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLAEGGTATTMVSKDIGMNCL fstl1_mouse Follistatin-related protein 1 Fstl1 Frp Fstl Tsc36 Follistatin-like protein 1 TGF-beta-inducible protein TSC-36 protein protein mouse Mus musculus Mouse MWKRWLALSLVTIALVHGEEEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSASPSASPVVCYQANRDELRRRLIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAINITTYADQENNKLLRSLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEKTGYVQELQKHQGTAEKTKKVNTKEI tgfb1_human Transforming growth factor beta-1 proprotein TGFB1 TGFB protein protein human Homo sapiens Human MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS bmp4_human Bone morphogenetic protein 4 BMP4 BMP2B DVR4 Bone morphogenetic protein 2B protein protein human Homo sapiens Human MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR fstl1-bmpr2-1 3225107 N/A 3225110 unspecified role unspecified role prey prey Region 27-1038 Region 27-1038 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3225111 unspecified role unspecified role bait bait Region 19-306 Region 19-306 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false This tag was used for western blot detection. in vitro In vitro physical association physical association false false false fstl1-tgfb1-1 3225108 N/A 3225112 unspecified role unspecified role prey prey Region 279-390 Region 279-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3225111 unspecified role unspecified role bait bait Region 19-306 Region 19-306 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false fstl1-bmp4-1 3225109 N/A 3225113 unspecified role unspecified role prey prey Region 293-408 Region 293-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3225111 unspecified role unspecified role bait bait Region 19-306 Region 19-306 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false