DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schme-2011-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schmöe K., Rogov VV., Rogova NY., Löhr F., Güntert P., Bernhard F., Dötsch V. DIP original experiment: DIP-218810X Structure (London, England : 1993) 2011 IMEx Structural insights into Rcs phosphotransfer: the newly identified RcsD-ABL domain enhances interaction with the response regulator RcsB. Schmöe K., Rogov VV., Rogova NY., Löhr F., Güntert P., Bernhard F., Dötsch V. Only protein-protein interactions imex curation schme-2011-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Schmöe K., Rogov VV., Rogova NY., Löhr F., Güntert P., Bernhard F., Dötsch V. DIP original experiment: DIP-218811X Structure (London, England : 1993) 2011 IMEx Structural insights into Rcs phosphotransfer: the newly identified RcsD-ABL domain enhances interaction with the response regulator RcsB. Schmöe K., Rogov VV., Rogova NY., Löhr F., Güntert P., Bernhard F., Dötsch V. Only protein-protein interactions imex curation rcsb_ecoli Transcriptional regulatory protein RcsB rcsB Capsular synthesis regulator component B JW2205 b2217 protein protein ecoli Escherichia coli (strain K12) MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD This sequence has been withdrawn from Uniprot. A78D1BD3004E0680 rcsd_ecoli Phosphotransferase RcsD yojP yojQ rcsD yojN b2216 JW2204 Phosphotransfer intermediate RcsD protein protein ecoli Escherichia coli (strain K12) MRQKETTATTRFSLLPGSITRFFLLLIIVLLVTMGVMVQSAVNAWLKDKSYQIVDITHAIQKRVDNWRYVTWQIYDNIAATTSPSSGEGLQETRLKQDVYYLEKPRRKTEALIFGSHDNSTLEMTQRMSTYLDTLWGAENVPWSMYYLNGQDNSLVLISTLPLKDLTSGFKESTVSDIVDSRRAEMLQQANALDERESFSNMRRLAWQNGHYFTLRTTFNQPGHLATVVAFDLPINDLIPPGMPLDSFRLEPDATATGNNDNEKEGTDSVSIHFNSTKIEISSALNSTDMRLVWQVPYGTLLLDTLQNILLPLLLNIGLLALALFGYTTFRHFSSRSTENVPSTAVNNELRILRAINEEIVSLLPLGLLVHDQESNRTVISNKIADHLLPHLNLQNITTMAEQHQGIIQATINNELYEIRMFRSQVAPRTQIFIIRDQDREVLVNKKLKQAQRLYEKNQQGRMIFMKNIGDALKEPAQSLAESAAKLNAPESKQLANQADVLVRLVDEIQLANMLADDSWKSETVLFSVQDLIDEVVPSVLPAIKRKGLQLLINNHLKAHDMRRGDRDALRRILLLLMQYAVTSTQLGKITLEVDQDESSEDRLTFRILDTGEGVSIHEMDNLHFPFINQTQNDRYGKADPLAFWLSDQLARKLGGHLNIKTRDGLGTRYSVHIKMLAADPEVEEEEERLLDDVCVMVDVTSAEIRNIVTRQLENWGATCITPDERLISQDYDIFLTDNPSNLTASGLLLSDDESGVREIGPGQLCVNFNMSNAMQEAVLQLIEVQLAQEEVTESPLGGDENAQLHASGYYALFVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCETLEHLIREKDVPGIEKYISDIDSYVKSLL rcsb-rcsd-1 3225094 N/A 3225096 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225097 unspecified role unspecified role unspecified role unspecified role ABL domain Region 688-795 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P39838:p.[Asn715Ala;Gln776Ala;Leu780Ala] N715A/Q776A/L780A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rcsb-rcsd-2 3225095 N/A 3225096 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225097 unspecified role unspecified role unspecified role unspecified role ABL domain Region 688-795 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false