DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rochel-2011-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249002X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249010X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249025X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-4 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249018X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249003X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-6 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249024X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249011X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-8 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249012X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-9 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249004X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-10 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249026X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249020X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-12 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249013X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-13 ecolx Escherichia coli sans small angle neutron scattering SANS SANS sans predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249005X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-14 in vitro In vitro sans small angle neutron scattering SANS SANS sans predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249019X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-15 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249028X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-16 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249006X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-17 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249014X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-18 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249021X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-19 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249015X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-20 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249027X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-21 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249007X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-22 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249016X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-23 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249023X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-24 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249008X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-25 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249017X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-26 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249022X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rochel-2011-27 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. DIP original experiment: DIP-249009X Nature structural & molecular biology 2011 IMEx Common architecture of nuclear receptor heterodimers on DNA direct repeat elements with different spacings. Rochel N., Ciesielski F., Godet J., Moman E., Roessle M., Peluso-Iltis C., Moulin M., Haertlein M., Callow P., Mély Y., Svergun DI., Moras D. Only protein-protein interactions imex curation rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP p37231-1 Peroxisome proliferator-activated receptor gamma PPARG NR1C3 Nuclear receptor subfamily 1 group C member 3 protein protein human Homo sapiens Human MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ncoa1_human Nuclear receptor coactivator 1 Steroid receptor coactivator 1 RIP160 Protein Hin-2 Renal carcinoma antigen NY-REN-52 NCOA1 SRC1 BHLHE74 Class E basic helix-loop-helix protein 74 protein protein human Homo sapiens Human MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINRQQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE vdr_human Vitamin D3 receptor 1,25-dihydroxyvitamin D3 receptor Nuclear receptor subfamily 1 group I member 1 VDR NR1I1 protein protein human Homo sapiens Human MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS med1_human Mediator of RNA polymerase II transcription subunit 1 TRIP2 MED1 ARC205 DRIP205 TRAP220 Activator-recruited cofactor 205 kDa component Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Thyroid hormone receptor-associated protein complex 220 kDa component Thyroid receptor-interacting protein 2 p53 regulatory protein RB18A Vitamin D receptor-interacting protein complex component DRIP205 CRSP1 CRSP200 DRIP230 PBP PPARBP PPARGBP RB18A protein protein human Homo sapiens Human MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN ncoa2_human Nuclear receptor coactivator 2 NCOA2 TIF2 Transcriptional intermediary factor 2 BHLHE75 Class E basic helix-loop-helix protein 75 SRC2 protein protein human Homo sapiens Human MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLSSNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC rara-rxra-6 3224774 N/A 3224801 unspecified role unspecified role prey prey Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role bait bait Region 82-421 Region 82-421 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false pparg-rxra-3 3224775 N/A 3224803 unspecified role unspecified role bait bait Region 135-505 Region 135-505 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role prey prey Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ncoa1-rxra-3 3224776 N/A 3224804 unspecified role unspecified role unspecified role unspecified role Region 616-763 Region 616-763 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false med1-rxra-1 3224777 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224806 unspecified role unspecified role unspecified role unspecified role Region 499-614 Region 499-614 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rara-rxra-7 3224778 N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-421 Region 82-421 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rxra-vdr-2 3224779 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pparg-rxra-4 3224780 N/A 3224803 unspecified role unspecified role unspecified role unspecified role Region 135-505 Region 135-505 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pparg-rxra-5 3224781 N/A 3224803 unspecified role unspecified role unspecified role unspecified role Region 135-505 Region 135-505 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rara-rxra-8 3224782 N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-421 Region 82-421 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false med1-rxra-2 3224783 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224806 unspecified role unspecified role unspecified role unspecified role Region 499-614 Region 499-614 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false med1-rara-1 3224784 N/A 3224806 unspecified role unspecified role unspecified role unspecified role Region 499-614 Region 499-614 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false pparg-rxra-6 3224785 N/A 3224803 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rara-rxra-9 3224786 N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-421 Region 82-421 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rara-rxra-10 3224787 N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-421 Region 82-421 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ncoa1-rara-3 3224788 N/A 3224804 unspecified role unspecified role unspecified role unspecified role Region 616-763 Region 616-763 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false med1-rara-2 3224789 N/A 3224806 unspecified role unspecified role unspecified role unspecified role Region 499-614 Region 499-614 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false pparg-rxra-7 3224790 N/A 3224803 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3224801 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ncoa2-rxra-2 3224791 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224807 unspecified role unspecified role unspecified role unspecified role Region 622-828 Region 622-828 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rara-rxra-11 3224792 N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ncoa2-rxra-3 3224793 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224807 unspecified role unspecified role unspecified role unspecified role Region 622-828 Region 622-828 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false vdr-rxra-7 3224794 N/A 3224805 unspecified role unspecified role bait bait Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role prey prey Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false med1-rara-3 3224795 N/A 3224806 unspecified role unspecified role unspecified role unspecified role Region 499-614 Region 499-614 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rara-rxra-12 3224796 N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rxra-vdr-3 3224797 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ncoa1-rara-4 3224798 N/A 3224804 unspecified role unspecified role unspecified role unspecified role Region 616-763 Region 616-763 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224802 unspecified role unspecified role unspecified role unspecified role Region 82-462 Region 82-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ncoa1-rxra-4 3224799 N/A 3224804 unspecified role unspecified role unspecified role unspecified role Region 616-763 Region 616-763 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rxra-vdr-4 3224800 N/A 3224805 unspecified role unspecified role unspecified role unspecified role Region 1-165/217-427 Region 1-165/217-427 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3224801 unspecified role unspecified role unspecified role unspecified role Region 130-462 Region 130-462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false