DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lackman-2011-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249212X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions imex curation lackman-2011-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249215X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions imex curation lackman-2011-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249213X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions imex curation lackman-2011-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249216X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions imex curation lackman-2011-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249214X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions imex curation lackman-2011-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. DIP original experiment: DIP-249217X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Jasmonate signaling involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming in Arabidopsis and tobacco. Lackman P., González-Guzmán M., Tilleman S., Carqueijeiro I., Pérez AC., Moses T., Seo M., Kanno Y., Häkkinen ST., Van Montagu MC., Thevelein JM., Maaheimo H., Oksman-Caldentey KM., Rodriguez PL., Rischer H., Goossens A. Only protein-protein interactions imex curation p2c16_arath Protein phosphatase 2C 16 HAB1 P2C-HA Protein phosphatase 2C HAB1 AtP2C-HA Protein HYPERSENSITIVE TO ABA 1 F28P22.4 At1g72770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEMTPAVAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSENQSFCNGGTECTMEDVSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGSELSLSNTAMEIDNGRVLATAIIVGESSIEQVPTAEVLIAGVNQDTNTSEVVIRLPDENSNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT q53hy7_tobac c17 LOC107816664 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MPPSSPDSSVLLQRISSNTTPDFACKQSQQLQRRTMPIPCTTQVPDSVVRFHTHPVGPNQCCSAVIQRISAPVSTVWSVVRRFDNPQAYKHFVKSCHVIVGDGDVGTLREVRVISGLPAASSTERLEILDDERHVISFSVVGGDHRLANYRSVTTLHPEPSGDGTTIVVESYVVDVPPGNTRDETCVFVDTIVKCNLTSLSQIAVNVNRRKDS pyl4_arath Abscisic acid receptor PYL4 At2g38310 PYL4 ABIP2 RCAR10 PYR1-like protein 4 ABI1-binding protein 2 Regulatory components of ABA receptor 10 T19C21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLAVHRPSSAVSDGDSVQIPMMIASFQKRFPSLSRDSTAARFHTHEVGPNQCCSAVIQEISAPISTVWSVVRRFDNPQAYKHFLKSCSVIGGDGDNVGSLRQVHVVSGLPAASSTERLDILDDERHVISFSVVGGDHRLSNYRSVTTLHPSPISGTVVVESYVVDVPPGNTKEETCDFVDVIVRCNLQSLAKIAENTAAESKKKMSL p2c56_arath Protein phosphatase 2C 56 Protein ABSCISIC ACID-INSENSITIVE 1 ABI1 At4g26080 F20B18.190 Protein phosphatase 2C ABI1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVSPAIAGPFRPFSETQMDFTGIRLGKGYCNNQYSNQDSENGDLMVSLPETSSCSVSGSHGSESRKVLISRINSPNLNMKESAAADIVVVDISAGDEINGSDITSEKKMISRTESRSLFEFKSVPLYGFTSICGRRPEMEDAVSTIPRFLQSSSGSMLDGRFDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDTWLEKWKKALFNSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHKPDREDEAARIEAAGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKEDDCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAAEYLSKLAIQRGSKDNISVVVVDLKPRRKLKSKPLN p2c37_arath Protein phosphatase 2C 37 F24K9.8 At3g11410 PP2CA AHG3 Protein ABA-HYPERSENSITIVE GERMINATION 3 Protein phosphatase 2C A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGICCGVVGETEPAAPVDSTSRASLRRRLDLLPSIKIVADSAVAPPLENCRKRQKRETVVLSTLPGNLDLDSNVRSENKKARSAVTNSNSVTEAESFFSDVPKIGTTSVCGRRRDMEDAVSIHPSFLQRNSENHHFYGVFDGHGCSHVAEKCRERLHDIVKKEVEVMASDEWTETMVKSFQKMDKEVSQRECNLVVNGATRSMKNSCRCELQSPQCDAVGSTAVVSVVTPEKIIVSNCGDSRAVLCRNGVAIPLSVDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCLRGAGAGDDSDAAHNACSDAALLLTKLALARQSSDNVSVVVVDLRKRRNNQASS c17-hab1-1 3223659 N/A 3223665 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3223666 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false pyl4-hab1-1 3223660 N/A 3223667 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3223665 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false c17-abi1-1 3223661 N/A 3223668 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3223666 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false pyl4-abi1-1 3223662 N/A 3223668 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3223667 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false c17-pp2ca-1 3223663 N/A 3223669 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3223666 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false pyl4-pp2ca-1 3223664 N/A 3223669 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3223667 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false