DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ collins-2011-1 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218782X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218785X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-3 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218786X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218783X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218789X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-6 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218784X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218787X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218790X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation collins-2011-9 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Collins MN., Hendrickson WA. DIP original experiment: DIP-218788X Structure (London, England : 1993) 2011 IMEx Structural characterization of the Boca/Mesd maturation factors for LDL-receptor-type β propeller domains. Collins MN., Hendrickson WA. Only protein-protein interactions imex curation mesd_drome LDLR chaperone boca boca CG30498 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPGVNAKKDEL q8ig33_caeel bmy-1 CELE_F09E5.17 F09E5.17 protein protein caeel Caenorhabditis elegans MKWRTVFIFLLAAHIGLANVKQKKKDLSSYTDAELEKLYEEWEENDEDELEEDEKPEHKRKPPQLDLESMKAKAKDPEDLLMMSKKGQTLMLFVGVVDPSQPDRSDIRPFTEKWTQIWQSQLYNNHVDLQVFVIDDNRAIFMFKNGEQAFEAKKFLLKQEFVSEVTIEGQSFDGPAKKFKTGKKEL mesd_mouse LRP chaperone MESD Mesd LDLR chaperone MESD Mesdc2 Mesoderm development candidate 2 Mesoderm development protein protein protein mouse Mus musculus Mouse MAASRWLRAVLLFLCASDLLLLPPPNAYAADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRREDL boca-1 3223309 N/A 3223318 unspecified role unspecified role unspecified role unspecified role Structured domain Region 88-172 sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bmy_1-1 3223310 N/A 3223319 unspecified role unspecified role unspecified role unspecified role Structured domain Region 84-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mesdc2-1 3223311 N/A 3223320 unspecified role unspecified role unspecified role unspecified role Structured domain Region 99-183 sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false boca-2 3223312 N/A 3223318 unspecified role unspecified role unspecified role unspecified role Structured domain Region 88-172 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bmy_1-2 3223313 N/A 3223319 unspecified role unspecified role unspecified role unspecified role Structured domain Region 84-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bmy_1-3 3223314 N/A 3223319 unspecified role unspecified role unspecified role unspecified role Structured domain Region 84-174 sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mesdc2-2 3223315 N/A 3223320 unspecified role unspecified role unspecified role unspecified role Region 99-183 Region 99-183 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mesdc2-3 3223316 N/A 3223320 unspecified role unspecified role unspecified role unspecified role Region 99-183 Region 99-183 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false boca-3 3223317 N/A 3223318 unspecified role unspecified role unspecified role unspecified role Structured domain Region 88-172 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false