DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lefvre-2011-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. DIP original experiment: DIP-218482X Nature structural & molecular biology 2011 IMEx Structure-function analysis of hRPC62 provides insights into RNA polymerase III transcription initiation. Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. Only protein-protein interactions imex curation lefvre-2011-2 ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. DIP original experiment: DIP-218484X Nature structural & molecular biology 2011 IMEx Structure-function analysis of hRPC62 provides insights into RNA polymerase III transcription initiation. Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. Only protein-protein interactions imex curation lefvre-2011-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. DIP original experiment: DIP-218483X Nature structural & molecular biology 2011 IMEx Structure-function analysis of hRPC62 provides insights into RNA polymerase III transcription initiation. Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. Only protein-protein interactions imex curation lefvre-2011-4 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. DIP original experiment: DIP-218485X Nature structural & molecular biology 2011 IMEx Structure-function analysis of hRPC62 provides insights into RNA polymerase III transcription initiation. Lefèvre S., Dumay-Odelot H., El-Ayoubi L., Budd A., Legrand P., Pinaud N., Teichmann M., Fribourg S. Only protein-protein interactions imex curation rpc7l_human DNA-directed RNA polymerase III subunit RPC7-like POLR3GL RNA polymerase III 32 kDa beta subunit DNA-directed RNA polymerase III subunit G-like protein protein human Homo sapiens Human MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKTTEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY rpc3_human DNA-directed RNA polymerase III subunit RPC3 POLR3C DNA-directed RNA polymerase III subunit C RNA polymerase III 62 kDa subunit protein protein human Homo sapiens Human MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRTFYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ rpc6_human DNA-directed RNA polymerase III subunit RPC6 DNA-directed RNA polymerase III subunit F RNA polymerase III 39 kDa subunit POLR3F protein protein human Homo sapiens Human MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF rpc7_human DNA-directed RNA polymerase III subunit RPC7 POLR3G DNA-directed RNA polymerase III subunit G RNA polymerase III 32 kDa subunit RNA polymerase III 32 kDa apha subunit protein protein human Homo sapiens Human MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY polr3c-polr3gl-3 3222956 N/A 3222960 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3222961 unspecified role unspecified role bait bait Q9BUI4:p.Leu312Lys L312K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region Δ450-508 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region Δ1-238 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region Δ1-78 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false polr3c-polr3f-1 3222957 N/A 3222962 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3222961 unspecified role unspecified role bait bait region Δ1-238 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region Δ1-78 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false polr3c-polr3g-3 3222958 N/A 3222963 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3222961 unspecified role unspecified role bait bait Q9BUI4:p.Leu312Lys L312K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region Δ1-238 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region Δ1-78 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false polr3f-polr3c-1 3222959 N/A 3222962 unspecified role unspecified role bait bait Region 158-316 Region 158-316 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3222961 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false