DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ parashar-2011-1 in vitro In vitro protein phosphatase assay protein phosphatase assay predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216763X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions imex curation parashar-2011-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216758X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions imex curation parashar-2011-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216759X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions imex curation parashar-2011-4 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216761X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions imex curation parashar-2011-5 in vitro In vitro protein phosphatase assay protein phosphatase assay autoradiography autoradiography Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216760X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions imex curation parashar-2011-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Parashar V., Mirouze N., Dubnau DA., Neiditch MB. DIP original experiment: DIP-216762X PLoS biology 2011 IMEx Structural basis of response regulator dephosphorylation by Rap phosphatases. Parashar V., Mirouze N., Dubnau DA., Neiditch MB. Only protein-protein interactions imex curation rapj_bacsu Response regulator aspartate phosphatase J ycdE BSU02820 rapJ protein protein bacsu Bacillus subtilis MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ E5EC939CE2B6E1DC sp0f_bacsu Sporulation initiation phosphotransferase F spo0F Stage 0 sporulation protein F BSU37130 protein protein bacsu Bacillus subtilis MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 4130377E3558D698 raph_bacsu Response regulator aspartate phosphatase H rapH PSP28 yeeH yzqA BSU06830 protein protein bacsu Bacillus subtilis MSQAIPSSRVGVKINEWYKMIRQFSVPDAEILKAEVEQDIQQMEEDQDLLIYYSLMCFRHQLMLDYLEPGKTYGNRPTVTELLETIETPQKKLTGLLKYYSLFFRGMYEFDQKEYVEAIGYYREAEKELPFVSDDIEKAEFHFKVAEAYYHMKQTHVSMYHILQALDIYQNHPLYSIRTIQSLFVIAGNYDDFKHYDKALPHLEAALELAMDIQNDRFIAISLLNIANSYDRSGDDQMAVEHFQKAAKVSREKVPDLLPKVLFGLSWTLCKAGQTQKAFQFIEEGLDHITARSHKFYKELFLFLQAVYKETVDERKIHDLLSYFEKKNLHAYIEACARSAAAVFESSCHFEQAAAFYRKVLKAQEDILKGECLYAY 74FABAA843676A74 kina_bacsu Sporulation kinase A kinA Stage II sporulation protein F Stage II sporulation protein J gsiC scoD spoIIF spoIIJ BSU13990 protein protein bacsu Bacillus subtilis MEQDTQHVKPLQTKTDIHAVLASNGRIIYISANSKLHLGYLQGEMIGSFLKTFLHEEDQFLVESYFYNEHHLMPCTFRFIKKDHTIVWVEAAVEIVTTRAERTEREIILKMKVLEEETGHQSLNCEKHEIEPASPESTTYITDDYERLVENLPSPLCISVKGKIVYVNSAMLSMLGAKSKDAIIGKSSYEFIEEEYHDIVKNRIIRMQKGMEVGMIEQTWKRLDGTPVHLEVKASPTVYKNQQAELLLLIDISSRKKFQTILQKSRERYQLLIQNSIDTIAVIHNGKWVFMNESGISLFEAATYEDLIGKNIYDQLHPCDHEDVKERIQNIAEQKTESEIVKQSWFTFQNRVIYTEMVCIPTTFFGEAAVQVILRDISERKQTEELMLKSEKLSIAGQLAAGIAHEIRNPLTAIKGFLQLMKPTMEGNEHYFDIVFSELSRIELILSELLMLAKPQQNAVKEYLNLKKLIGEVSALLETQANLNGIFIRTSYEKDSIYINGDQNQLKQVFINLIKNAVESMPDGGTVDIIITEDEHSVHVTVKDEGEGIPEKVLNRIGEPFLTTKEKGTGLGLMVTFNIIENHQGVIHVDSHPEKGTAFKISFPKK A8BB97FE844B32EE rapj-spo0f-1 3222912 N/A 3222918 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3222919 enzyme target enzyme target substrate substrate unspecified role unspecified role 32p-label 32p-label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false raph-spo0f-1 3222913 N/A 3222920 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3222919 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false raph-1 3222914 N/A 3222920 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kina-spo0f-1 3222915 N/A 3222921 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3222919 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false raph-spo0f-2 3222916 N/A 3222920 enzyme enzyme unspecified role unspecified role Q59HN8:p.Gln47Asn Q47N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q59HN8:p.Leu50Ala L50A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q59HN8:p.Phe58Ala F58A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q59HN8:p.Asp134Ala D134A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q59HN8:p.Tyr175Ala Y175A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q59HN8:p.Glu137Ala E137A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3222919 enzyme target enzyme target substrate substrate unspecified role unspecified role 32p-label 32p-label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false rapj-1 3222917 N/A 3222918 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false