DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dray-2011-1 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. DIP original experiment: DIP-253458X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1). Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. Only protein-protein interactions imex curation dray-2011-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. DIP original experiment: DIP-253463X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1). Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. Only protein-protein interactions imex curation dray-2011-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. DIP original experiment: DIP-253461X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1). Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. Only protein-protein interactions imex curation dray-2011-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. DIP original experiment: DIP-253459X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1). Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. Only protein-protein interactions imex curation dray-2011-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. DIP original experiment: DIP-253462X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1). Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. Only protein-protein interactions imex curation dray-2011-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. DIP original experiment: DIP-253460X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1). Dray E., Dunlop MH., Kauppi L., San Filippo J., Wiese C., Tsai MS., Begovic S., Schild D., Jasin M., Keeney S., Sung P. Only protein-protein interactions imex curation dmc1_human Meiotic recombination protein DMC1/LIM15 homolog DMC1 DMC1H LIM15 protein protein human Homo sapiens Human MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE q96b01-2 RAD51-associated protein 1 RAD51AP1 PIR51 RAD51-interacting protein protein protein human Homo sapiens Human MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKRMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMRKSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSAESKKPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST Ref.3 (AAH05973) sequence differs from that shown due to a frameshift in position 59 q96b01-3 RAD51-associated protein 1 RAD51AP1 PIR51 RAD51-interacting protein protein protein human Homo sapiens Human MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKRLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMRKSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD q96b01-1 RAD51-associated protein 1 RAD51AP1 PIR51 RAD51-interacting protein protein protein human Homo sapiens Human MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKRLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMRKSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSAESKKPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST No experimental confirmation available rad51ap1-dmc1-1 3222569 N/A 3222575 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3222576 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false rad51ap1-rad51-3 3222570 N/A 3222577 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3222578 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false rad51ap1-rad51-4 3222571 N/A 3222578 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3222576 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false rad51ap1-dmc1-2 3222572 N/A 3222575 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3222576 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false rad51ap1-rad51-5 3222573 N/A 3222578 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3222579 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false rad51ap1-dmc1-4 3222574 N/A 3222579 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3222575 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false