DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ navarro-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. DIP original experiment: DIP-216757X PLoS biology 2011 IMEx Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis. Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. Only protein-protein interactions imex curation navarro-2011-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. DIP original experiment: DIP-216752X PLoS biology 2011 IMEx Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis. Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. Only protein-protein interactions imex curation navarro-2011-3 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. DIP original experiment: DIP-216755X PLoS biology 2011 IMEx Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis. Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. Only protein-protein interactions imex curation navarro-2011-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. DIP original experiment: DIP-216753X PLoS biology 2011 IMEx Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis. Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. Only protein-protein interactions imex curation navarro-2011-5 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. DIP original experiment: DIP-216756X PLoS biology 2011 IMEx Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis. Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. Only protein-protein interactions imex curation navarro-2011-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. DIP original experiment: DIP-216754X PLoS biology 2011 IMEx Structural basis for c-di-GMP-mediated inside-out signaling controlling periplasmic proteolysis. Navarro MV., Newell PD., Krasteva PV., Chatterjee D., Madden DR., O'Toole GA., Sondermann H. Only protein-protein interactions imex curation q3kk31_psepf lapD Pfl01_0131 protein protein psepf Pseudomonas fluorescens MSLFKQLLIAICLFLVVAFTGSFMVSLESSRTQYVNQLRSHAQDAATALALSLTPNIDDPAMVELLVSSIFDSGYYSSIRVVDLKTDQTIVERNGIPAVTNVPDWFVKLIGLEPAGGDALVSRGWEQAARVEVVSHPMFALAKLWQSALGSLGWLLVCGAVSAVLGALLLRRQLKPLDYMVKQSHAIARREFLSLPDLPRTPELRRVVLAMNQMVEKLKALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDQSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG q3kk32_psepf lapF Pfl01_0130 protein protein psepf Pseudomonas fluorescens MFFAGLTFTIKRFLLCPGCLALAVRFAIPRIARWLACALLLAGIMLGGLHADWDFSAISRKATALYGPLGAGQQRIDAWQNLLATQKQVSEMEKLKVVNLFFNKQMRYVEDIDLWHEVDYWETPIEALWKGAGDCEDYAIAKYFSLRHLGVASDKLRITYVKALRQNRAHMVLTYYSSPDAMPLVLDSLIDPIKPAAERTDLLPVYSFNAEGLYLPGAKGNKKVGDTKRLSRWQDVLKKMQAEGFPVETTN lapd-1 3222536 N/A 3222542 unspecified role unspecified role unspecified role unspecified role Output domain Region 22-151 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lapf-lapd-2 3222537 N/A 3222542 unspecified role unspecified role prey prey Output domain Region 22-151 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q3KK31:p.Trp125Glu W125E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3222543 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false lapd-3 3222538 N/A 3222542 unspecified role unspecified role unspecified role unspecified role EAL domain Region 399-648 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q3KK31:p.Ala602Glu A602E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q3KK31:p.[Ser229Asp;Ala602Glu] S229D/A602E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lapd-4 3222539 N/A 3222542 unspecified role unspecified role unspecified role unspecified role EAL domain Region 399-648 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lapd-5 3222540 N/A 3222542 unspecified role unspecified role unspecified role unspecified role Dual domain Region 220-648 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lapd-6 3222541 N/A 3222542 unspecified role unspecified role unspecified role unspecified role EAL domain Region 399-648 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q3KK31:p.Ala602Glu A602E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q3KK31:p.[Ser229Asp;Ala602Glu] S229D/A602E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false