DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ smith-2011-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. DIP original experiment: DIP-218758X Structure (London, England : 1993) 2011 IMEx Structural basis of Streptococcus pyogenes immunity to its NAD+ glycohydrolase toxin. Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. Only protein-protein interactions imex curation smith-2011-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. DIP original experiment: DIP-218756X Structure (London, England : 1993) 2011 IMEx Structural basis of Streptococcus pyogenes immunity to its NAD+ glycohydrolase toxin. Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. Only protein-protein interactions imex curation smith-2011-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. DIP original experiment: DIP-218759X Structure (London, England : 1993) 2011 IMEx Structural basis of Streptococcus pyogenes immunity to its NAD+ glycohydrolase toxin. Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. Only protein-protein interactions imex curation smith-2011-8 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. DIP original experiment: DIP-218757X Structure (London, England : 1993) 2011 IMEx Structural basis of Streptococcus pyogenes immunity to its NAD+ glycohydrolase toxin. Smith CL., Ghosh J., Elam JS., Pinkner JS., Hultgren SJ., Caparon MG., Ellenberger T. Only protein-protein interactions imex curation q2vj58_strpy E0F66_06230 ifs GTK54_00720 SPNIH34_01310 protein protein strpy Streptococcus pyogenes MYKVPKGLEHYQKMFQKEVTVNDLKKYLIGSDKEYRITRRDSYMGDISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALDIYQAVQTLNAENMLLNYYESLPFYLNRQSILANITKALKDAHIREAMAHYKLGEFAHYQDTMLDMVERTIETF BEB604A6FB730D7B q5xe42_strp6 M6_Spy0186 protein protein strp6 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKKSDVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASPMRIGRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEIDKKLDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAVASRAEYYRMYVSRKYQYKKEFVEKLKQVYKESGASHVTSKKDLMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK D9FBF97B708F7828 ifs-spn-1 3222327 N/A 3222331 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3222332 unspecified role unspecified role unspecified role unspecified role C-terminal glycohydrolase domain Region 194-454 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false spn-ifs-1 3222328 N/A 3222331 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3222332 unspecified role unspecified role bait bait C-terminal glycohydrolase domain Region 194-454 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false ifs-spn-2 3222329 N/A 3222331 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3222332 unspecified role unspecified role unspecified role unspecified role C-terminal glycohydrolase domain Region 194-454 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ifs-spn-3 3222330 N/A 3222331 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3222332 unspecified role unspecified role unspecified role unspecified role C-terminal glycohydrolase domain Region 194-454 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false