DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mechaly-2011-1 actfr Actinia fragacea Strawberry anemone x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mechaly AE., Bellomio A., Gil-Cartón D., Morante K., Valle M., González-Mañas JM., Guérin DM. DIP original experiment: DIP-218754X Structure (London, England : 1993) 2011 IMEx Structural insights into the oligomerization and architecture of eukaryotic membrane pore-forming toxins. Mechaly AE., Bellomio A., Gil-Cartón D., Morante K., Valle M., González-Mañas JM., Guérin DM. Only protein-protein interactions imex curation mechaly-2011-2 actfr Actinia fragacea Strawberry anemone 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Mechaly AE., Bellomio A., Gil-Cartón D., Morante K., Valle M., González-Mañas JM., Guérin DM. DIP original experiment: DIP-218755X Structure (London, England : 1993) 2011 IMEx Structural insights into the oligomerization and architecture of eukaryotic membrane pore-forming toxins. Mechaly AE., Bellomio A., Gil-Cartón D., Morante K., Valle M., González-Mañas JM., Guérin DM. Only protein-protein interactions imex curation actpc_actfr DELTA-actitoxin-Afr1a Alpha-helical pore-forming toxin Cytolysin Fragaceatoxin C protein protein actfr Actinia fragacea Strawberry anemone SADVAGAVIDGAGLGFDVLKTVLEALGNVKRKIAVGIDNESGKTWTAMNTYFRSGTSDIVLPHKVAHGKALLYNGQKNRGPVATGVVGVIAYSMSDGNTLAVLFSVPYDYNWYSNWWNVRVYKGQKRADQRMYEELYYHRSPFRGDNGWHSRGLGYGLKSRGFMNSSGHAILEIHVTKA actpc_actfr-1 3222320 N/A 3222322 unspecified role unspecified role unspecified role unspecified role actfr Actinia fragacea Strawberry anemone direct interaction direct interaction false false false actpc_actfr-2 3222321 N/A 3222322 unspecified role unspecified role unspecified role unspecified role actfr Actinia fragacea Strawberry anemone direct interaction direct interaction false false false