DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ takemoto-2011-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249156X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-2 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249139X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249152X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-4 epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249143X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249147X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249153X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-7 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249140X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249149X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249159X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-10 epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249144X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249148X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-12 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249141X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249158X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249150X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249154X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-16 epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249145X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-17 epichloe festucae Epichloe festucae bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249142X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249151X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249155X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249157X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation takemoto-2011-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. DIP original experiment: DIP-249146X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Polarity proteins Bem1 and Cdc24 are components of the filamentous fungal NADPH oxidase complex. Takemoto D., Kamakura S., Saikia S., Becker Y., Wrenn R., Tanaka A., Sumimoto H., Scott B. Only protein-protein interactions imex curation d1myr7_9hypo BemA protein protein epichloe festucae Epichloe festucae MTLIQALRRSIKGDKKEQHHTSLGTKSAVAIIPPKKVIRALYDYEAQSSQELSFSKGDFFHVIGRENDEDWYEACNPALPDARGLVPVSFFQALGRTERDSAQSDGGRPPTAKSPDHDSGYSEHSPHPIATAMPISHRSTKSTDIDNKIFAIVMYDFEAQRADELGATKGEQIIIIAQSTAEWFVAKPIARLGGPGLIPVSYVEIRSVKTREVVPNALEAVRKAGVPSVEEWKKMAASYKNSSITLGKFEGGAGPGGGGGQQGIEQGMDRMSLQTGRQSAQNGSQPRAGQNNNVSQSNQFAPSQSTPQLYAPTRAWIPRYCFAEDKYWFVIVAVLDDGRHWELSRYYEDFYDFQIALLTEFPAEAGNAGGQKRTLPYMPGPVSYVTDAITEGRLHNLDAYVKNLLNQPEYISRCNLVKQFFAPREGDYEVDPNETEQEYRLSQGSQQSAESPGNNGSRSNLNGNGYAGHSATPRQTSNSQQGMPSQQQGGQAPQMKVKMYFNGDLIAIRVPSAADYQQLCDKVRERLKISQDDQLQLFYKDEPTGNKPSLMSDGDLDFALQRNEKLVLYVEVV d1myr8_9hypo Cdc24 protein protein epichloe festucae Epichloe festucae MAHAPLLRNNTAPVFQSNQSGFKNITQAKTMSSAPRGSQLSGSTAYAGSSTSLSSLASAATVVPGQNGGPIMATTNIINQKADASRSLYQICVSLKQRLSQVPDFTPFLEQLDPSDPVDPLWNLLRTGYPLLTIYNSLQPTEPLKVEDQIASEAKKSKIAIFKFVQACMKELQVPPAQSFVITDLMGNDTSGFVKVTQVVNYVLDLADQRGLLLQLQPYPEDEPAATTGSAQMSYRDHIVKELVDTERKYVQDLENLHDLKKTLEQKGLIPGDIVHQIFLNINAILDFQRRFLIRVETTNSMPKAVQRWGAPFCFYEDAFDIYQPFIANQRKAAQIANIVFDKIQQSGHPVATDFNTLDGFLLKPMQRLVKYPLLLKDLAKKSDDPQVKDDLCTGCEAAERVLQKANEAVNRDLLDEALEELITRVDDWKSHKVESFGKLLLHGVYGVITGKSDQEKEYEIYLFECILLCCKESSGKKDKTRSTGPKIKNRNGKLQLKGRIFMTNVTDVVSLSKPGSHSVQIWWRGDPGVENFTIKFLNEEMMRKWAVGLETQRKENAPRHSQSQESISNDFAWTRDHAGGLENPYLSQQEDDEEDHGPATAPTQYPVPRTSSSGNLRQRSATGDSTQSLAGIARAPPPRFPMPIPPASLSLQTQSSGAQSPSSRGGDSYFSPVAESPASSRTSTASGIFPGPAYQFPPKAGTPQSVWDDPRYAPGAMPRAPSRDGSSSSNTHGMAGGGRNARGPSLPAMATHSQTAAQQQQQQQRSRSYSTPDVNGAGISRQRQPSQSNIPAVPGIPQHLHPAHDGNIPRSQTGSPRNDLPIRTSTQSPGAQRERMHQHSGSLGGAMSHFATQPLYSRGNTPGPTGGDLLRVDSAAANSRNASPSIGTGSLTSTGNPLATPDLPMPTQLKVRVNCDSGNYVTLVVAFNITYQSLIDRIDAKLARFMTSSIGKGTLKLRYRDEDGDSVTIESDDDIQIAFMEWREGVRNMYSGGVGEIELFCVGEGQ a0jc82_9hypo noxR protein protein epichloe festucae Epichloe festucae MSLKLEIETWVAALARYDNNEFDDALGEFDKICDTSKILFNMGVIHATLGEHEKAVECYQRAIRLDQYLAVAYFQQGVSNFLLGDFEEALANFNDTLLYLRGNTMIDYAQLGLLFKLYSCEVLFNRGLCYIYLQQQDVGMQDLTYAVKEKVVEDHNVIDEAIREEAEGYTVFSIPVGVVYRPNEAKVRNLKTKDYLGKARLVAASDRSNAFTGFTGSEIKNAGKMEVKDDRPADNISFAATNLVKPGIQSRRQQPEPSANRNVFPPTPPPDNDRPSRGSSVRNGSRPMPAKLTIQTQDSNRKYEKAPSPEEVRATRSAASSTPSQGFSRRDHPPIQRRPTRRIDEMEEADAGDLYDMYQGSGSNRRTSRDSRRPSVRSRTQPRYYDDDDGSDYDDGSLDGAEFEMVSNNRRRQGSRSESRATSRRPEIRKIRVKVHAGDVRYIMIGAAIEYPDFVDRIKDKFGMKRRFKIKIPDEDMPDGDMITVGDQDDLEMAIQSSTSLAKRQRQDVAKMEIWIFEL cdc24-bema-1 3221826 N/A 3221847 unspecified role unspecified role prey prey PB1 domain Region 488-573 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false D1MYR7:p.Lys498Ala K498A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221848 unspecified role unspecified role bait bait PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false noxr-cdc24-1 3221827 N/A 3221848 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3221849 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false noxr-cdc24-2 3221828 N/A 3221848 unspecified role unspecified role prey prey PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role bait bait PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false A0JC82:p.Lys434Ala K434A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bema-noxr-1 3221829 N/A 3221847 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae N/A 3221849 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae physical association physical association false false false noxr-bema-1 3221830 N/A 3221849 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221847 unspecified role unspecified role prey prey Δ495-573 Δ495-573 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bema-cdc24-1 3221831 N/A 3221847 unspecified role unspecified role bait bait PB1 domain Region 488-573 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221848 unspecified role unspecified role prey prey PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false noxr-bema-2 3221832 N/A 3221847 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3221849 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false cdc24-noxr-1 3221833 N/A 3221848 unspecified role unspecified role bait bait Δ910-1007 Δ910-1007 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cdc24-noxr-2 3221834 N/A 3221848 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role prey prey Δ429-519 Δ429-519 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cdc24-noxr-3 3221835 N/A 3221848 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae N/A 3221849 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae physical association physical association false false false noxr-noxr-1 3221836 N/A 3221849 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bema-cdc24-2 3221837 N/A 3221848 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3221847 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false noxr-bema-3 3221838 N/A 3221849 unspecified role unspecified role bait bait Region 1-428 Region 1-428 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Δ276-519 Δ276-519 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221847 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false noxr-noxr-2 3221839 N/A 3221849 unspecified role unspecified role prey prey PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role bait bait PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cdc24-bema-2 3221840 N/A 3221847 unspecified role unspecified role prey prey PB1 domain Region 488-573 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221848 unspecified role unspecified role bait bait PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false D1MYR8:p.Asp962Ala D962A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false bema-cdc24-3 3221841 N/A 3221848 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae N/A 3221847 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae physical association physical association false false false noxr-noxr-3 3221842 N/A 3221849 unspecified role unspecified role unspecified role unspecified role C-terminal domain of GFP cGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae N/A 3221849 unspecified role unspecified role unspecified role unspecified role N-terminal domain of GFP nGFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false epichloe festucae Epichloe festucae physical association physical association false false false cdc24-noxr-4 3221843 N/A 3221848 unspecified role unspecified role bait bait PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role prey prey PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false noxr-cdc24-3 3221844 N/A 3221848 unspecified role unspecified role prey prey PB1 domain Region 905-1007 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false D1MYR8:p.Asp962Ala D962A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221849 unspecified role unspecified role bait bait PB1 domain Region 424-519 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cdc24-bema-3 3221845 N/A 3221848 unspecified role unspecified role bait bait Δ910-1007 Δ910-1007 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221847 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false cdc24-bema-4 3221846 N/A 3221848 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3221847 unspecified role unspecified role prey prey Region 1-494 Region 1-494 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Δ317-573 Δ317-573 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false