DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ freinkman-2011-1 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253422X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-2 ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253420X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-3 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253424X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-4 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253428X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-5 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253429X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-6 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253426X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-7 ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253431X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-8 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253421X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-9 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253423X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-10 ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253427X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-11 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253430X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation freinkman-2011-12 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Freinkman E., Chng SS., Kahne D. DIP original experiment: DIP-253425X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel. Freinkman E., Chng SS., Kahne D. Only protein-protein interactions imex curation lptd_ecoli LPS-assembly protein LptD lptD ostA b0054 yabG Organic solvent tolerance protein JW0053 imp protein protein ecoli Escherichia coli (strain K12) MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQNTL lpte_ecoli LPS-assembly lipoprotein LptE lptE b0641 JW0636 Rare lipoprotein B rlpB protein protein ecoli Escherichia coli (strain K12) MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN lptd-lpte-10 3221373 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lpte-lptd-5 3221374 N/A 3221385 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3221386 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false lptd-lpte-11 3221375 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-12 3221376 N/A 3221385 unspecified role unspecified role unspecified role unspecified role pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-13 3221377 N/A 3221385 unspecified role unspecified role unspecified role unspecified role pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-14 3221378 N/A 3221385 unspecified role unspecified role unspecified role unspecified role S538 S538 xlnk-res-res crosslinked residues XLNK-Res-Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-15 3221379 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-16 3221380 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-17 3221381 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lpte-lptd-6 3221382 N/A 3221385 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3221386 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false Deletion of region 529-538 decreased the interaction rate/strength. lptd-lpte-18 3221383 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-19 3221384 N/A 3221385 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3221386 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false pBPA pBPA modphe modified L-phenylalanine residue ModPhe certain certain sequence position certain certain certain sequence position certain false pBPA pBPA cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false