DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2011-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218437X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218455X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218448X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-9 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218445X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-10 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218453X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218441X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-12 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218438X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218449X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-14 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218458X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218442X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-16 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218452X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-17 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218439X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218450X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218443X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-20 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218446X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-21 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218454X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-22 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218457X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-23 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218447X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-24 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218451X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-25 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218456X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-26 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218440X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation chen-2011-27 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. DIP original experiment: DIP-218444X Nature structural & molecular biology 2011 IMEx A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms. Chen Y., Rai R., Zhou ZR., Kanoh J., Ribeyre C., Yang Y., Zheng H., Damay P., Wang F., Tsujii H., Hiraoka Y., Shore D., Hu HY., Chang S., Lei M. Only protein-protein interactions imex curation te2ip_human Telomeric repeat-binding factor 2-interacting protein 1 DRIP5 TERF2IP RAP1 PP8000 Dopamine receptor-interacting protein 5 Repressor/activator protein 1 homolog protein protein human Homo sapiens Human MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN taz1_schpo Telomere length regulator taz1 taz1 myb myb1 SPAC16A10.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MISVQSTETIQKVLENEGDQQFDKEVVQNSDSNIETGQISDSLTKAVEERAETESSSNLSNFTTSESESSKPAYCFNSHSQNMAEGSISIPVISHSMNVENEVSTAEGQDSRTGESENDQNAMIVRSIWDIEKASLLVNDCQNIANMAEQKVMMVSAIFSESSKDIVNPESFSERLGKETVKDLYEFNEQLTTKYGLEFRTIFFSYIRKYDAYWCLFEDLEKPLKSIQFFTGLIDLLDNTNKHLTLRSIVLDALLSADEEDSFYGDALVLFEELVIRYFGTDSNPSIDASEFILSCLPYTSLDALNVVCGQVWKSQKICDFLKSTIGNTSNSPLQLRASFPAFVNAVIHFLLEFKNVRRLERKDLSVKGMLYDSDSQQILNRLRERVSGSTAQSADEASGHESDASEDTFSERTLGLNSIDNTEISEVVSLGLVSSALDKITGLLSADNLSETVSQARDFSHTLSKSLKSRAKSLSQKEAANRSKLIAKRGDNLRREASLSSEQDDLSEDFPPVRESDEQESRSGGRSSAMRVSIERSAARSGTRRSQGNPYEGYRTRRKWTDEEENELYEMISQHGCCWSKIIHIQKLENGPLKTFGPTQIKDKARLIKARFMKQNRLQELYSKSLNWKNVTVGQAYCELHKIPYIEATPPLLREELVNYQS 5852F21518031152 rap1_schpo DNA-binding protein rap1 rap1 SPBC1778.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFTFTKSDGSSILFAVSKNFEHIRGFKNAIDCFKGKIEFLSFDKVDPTKHDYYLVAEDERVSDLDIPKGFFERNPEFRHKMLKIAWITQCIEQGKLLPTESFEVELNQDDVNRTHDGFRKRELFTLEDEKILIDHVHKNDINRFGTKVYEELARKYPQHSLESWRQHYKYMKKRLPPVSDSDESNYCQRIIVKPYSSQKDYTQSTHEQTLSSPISKSASVSKSENKALVNNKRYSDSYFYFSKMRRISIDVDYVDEDLNLINAYLSQFGKKRSLNELCALLSRRFSNRHTFSEWRALFMHFFPFINSEGVDPAILSDRETSAMLDETSDNEVADIDDQMIERKYLFSASEPNTVKSTNRLIFSERKAYAADDSIDNTPSKVPIVNSLSDPRTNRPFFYSNPDSMYRSISNPLHLVDSQHLSPLNRKTHFNNPIGQPQFTCLDDHEKTLRETSFRSLDDMSLRKSNSDNIFVKPGEDLEIPLLSDYSDSENISEKSSDDEEAFEKQVTSSYSSPIKVKSQGKSSKGSSGLDVREHEGSDDDAEVFVDRSPESFGATKVAHTSLEGNAASHKKVEENMQQPVTKKQKKYRMVNEEAHTGPTIIIPSDNNEKVTTLPAGHVPSEEKGKFINLAMHELQNEVSILRSSVNHREVDEAIDNILRYTNSTEQQFLEAMESTGGRVRIAIAKLLSKQTS 77C5070697D1A9CF sir3_yeast Regulatory protein SIR3 SIR3 CMT1 MAR2 STE8 L9753.10 YLR442C Silent information regulator 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVSGQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRGTSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSEEIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNPEVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQETQEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFATLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKACSSSGRETILSNFNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELAGMDALYEKIWFAISKENLCGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQKIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAINGFKDETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNMDCI CA2503D7645397AC rap1_yeast DNA-binding protein RAP1 RAP1 GRF1 TUF1 YNL216W N1310 SBF-E Repressor/activator site-binding protein TUF protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPDDFETAPAEYVDALDPSMVVVDSGSAAVTAPSDSAAEVKANQNEENTGATAAETSEKVDQTEVEKKDDDDTTEVGVTTTTPSIADTAATANIASTSGASVTEPTTDDTAADEKKEQVSGPPLSNMKFYLNRDADAHDSLNDIDQLARLIRANGGEVLDSKPRESKENVFIVSPYNHTNLPTVTPTYIKACCQSNSLLNMENYLVPYDNFREVVDSRLQEESHSNGVDNSNSNSDNKDSIRPKTEIISTNTNGATEDSTSEKVMVDAEQQARLQEQAQLLRQHVSSTASITSGGHNDLVQIEQPQKDTSNNNNSNVNDEDNDLLTQDNNPQTADEGNASFQAQRSMISRGALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRARNYSSQRNVQPTANAASANAAAAAAAAASNSYAIPENELLDEDTMNFISSLKNDLSNISNSLPFEYPHEIAEAIRSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL 67C4AFB03B3C0713 dcr1b_human 5' exonuclease Apollo DCLRE1B SNM1B DNA cross-link repair 1B protein SNM1 homolog B Beta-lactamase DCLRE1B protein protein human Homo sapiens Human MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC terf2-terf2ip-4 3220466 N/A 3220488 unspecified role unspecified role unspecified role unspecified role RCT domain Region 303-399 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220489 unspecified role unspecified role unspecified role unspecified role RBM domain Region 275-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false terf2-terf2ip-5 3220467 N/A 3220488 unspecified role unspecified role prey prey RCT domain Region 303-399 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3220489 unspecified role unspecified role bait bait RBM domain Region 275-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false terf2-terf2ip-6 3220468 N/A 3220488 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3220489 unspecified role unspecified role bait bait Q15554:p.Leu330Arg L288R/E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q15554:p.Leu330Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sprap1-taz1-1 3220469 N/A 3220490 unspecified role unspecified role unspecified role unspecified role RBM domain Region 365-396 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220491 unspecified role unspecified role unspecified role unspecified role RCT domain Region 639-693 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q96TL7:p.Ile655Arg I655R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q96TL7:p.Val651Arg V651R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false scrap1-sir3-1 3220470 N/A 3220492 unspecified role unspecified role unspecified role unspecified role RBM domain Region 456-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220493 unspecified role unspecified role unspecified role unspecified role RCT domain Region 679-827 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P11938:p.Pro730Arg P730R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P11938:p.Ala733Arg A733R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P11938:p.Val737Arg V737R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P11938:p.Leu755Arg L755R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P11938:p.Gly760Arg G760R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false terf2-terf2ip-7 3220471 N/A 3220488 unspecified role unspecified role prey prey Q9NYB0:p.Ile318Arg I318R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9NYB0:p.Phe336Arg F336R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3220489 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false terf2-terf2ip-8 3220472 N/A 3220488 unspecified role unspecified role unspecified role unspecified role RCT domain Region 303-399 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220489 unspecified role unspecified role unspecified role unspecified role RBM domain Region 275-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false terf2-terf2ip-9 3220473 N/A 3220488 unspecified role unspecified role prey prey Q9NYB0:p.Ile318Arg I318R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9NYB0:p.Phe336Arg F336R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3220489 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sir3-scrap1-1 3220474 N/A 3220492 unspecified role unspecified role bait bait RBM domain Region 456-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3220493 unspecified role unspecified role prey prey RCT domain Region 679-827 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false terf2-terf2ip-10 3220475 N/A 3220488 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3220489 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q15554:p.Leu330Arg L288R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false scrap1-sir3-2 3220476 N/A 3220492 unspecified role unspecified role unspecified role unspecified role RBM domain Region 456-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220493 unspecified role unspecified role unspecified role unspecified role RCT domain Region 679-827 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false terf2-terf2ip-11 3220477 N/A 3220488 unspecified role unspecified role unspecified role unspecified role RCT domain Region 303-399 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220489 unspecified role unspecified role unspecified role unspecified role Q15554:p.Leu330Arg L288R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false RBM domain Region 275-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false taz1-sprap1-1 3220478 N/A 3220490 unspecified role unspecified role bait bait P79005:p.Leu383Ala L383R/A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Ile379Arg I379R/A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Leu380Arg L380R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Leu383Arg L383R/A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Arg384Glu R384E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Arg386Glu R386E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Ile379Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3220491 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false terf2-dclre1b-2 3220479 N/A 3220494 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3220489 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false sprap1-taz1-2 3220480 N/A 3220490 unspecified role unspecified role unspecified role unspecified role RBM domain Region 365-396 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P79005:p.Ile379Arg I379R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Leu380Arg L380R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Leu383Arg L383R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P79005:p.Val387Arg V387R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220491 unspecified role unspecified role unspecified role unspecified role RCT domain Region 639-693 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false scrap1-sir3-3 3220481 N/A 3220492 unspecified role unspecified role unspecified role unspecified role RBM domain Region 456-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P06701:p.Ile463Arg I463R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06701:p.Phe465Arg F465R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06701:p.Leu468Arg L468R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P06701:p.Leu471Arg L471R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220493 unspecified role unspecified role unspecified role unspecified role RCT domain Region 679-827 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false scrap1-sir3-4 3220482 N/A 3220492 unspecified role unspecified role prey prey RBM domain Region 456-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3220493 unspecified role unspecified role bait bait RCT domain Region 679-827 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false taz1-sprap1-2 3220483 N/A 3220490 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3220491 unspecified role unspecified role prey prey Q96TL7:p.Ile655Arg I655R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q96TL7:p.Val651Arg V651R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false scrap1-sir3-5 3220484 N/A 3220492 unspecified role unspecified role unspecified role unspecified role RBM domain Region 456-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220493 unspecified role unspecified role unspecified role unspecified role RCT domain Region 679-827 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false terf2ip-terf2-3 3220485 N/A 3220488 unspecified role unspecified role bait bait RCT domain Region 303-399 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3220489 unspecified role unspecified role prey prey RBM domain Region 275-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false terf2-terf2ip-12 3220486 N/A 3220488 unspecified role unspecified role unspecified role unspecified role RCT domain Region 303-399 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9NYB0:p.Ile318Arg I318R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9NYB0:p.Phe336Arg F336R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220489 unspecified role unspecified role unspecified role unspecified role RBM domain Region 275-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sprap1-taz1-3 3220487 N/A 3220490 unspecified role unspecified role unspecified role unspecified role RBM domain Region 365-396 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220491 unspecified role unspecified role unspecified role unspecified role RCT domain Region 639-693 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false