DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hu-2011-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253358X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253350X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253353X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-7 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253356X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253352X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-9 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253351X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-10 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253354X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-11 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253355X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-12 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253357X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation hu-2011-13 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. DIP original experiment: DIP-253359X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu SH., Christie MP., Saez NJ., Latham CF., Jarrott R., Lua LH., Collins BM., Martin JL. Only protein-protein interactions imex curation q60770-1 Syntaxin-binding protein 3 Stxbp3 Stxbp3a Unc18c MUNC-18-3 Mammalian homolog of Unc-18c Protein unc-18 homolog 3 Protein unc-18 homolog C protein protein mouse Mus musculus Mouse MAPPVSERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFKDE stx4_mouse Syntaxin-4 Stx4 Stx4a protein protein mouse Mus musculus Mouse MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST stx4-stxbp3-3 3220130 N/A 3220140 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3220141 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false stx1a-stxbp1-18 3220131 N/A 3220142 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3220143 unspecified role unspecified role bait bait Region 1-261 Region 1-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false stx1a-stxbp1-19 3220132 N/A 3220142 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3220143 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false stx4-stxbp3-4 3220133 N/A 3220140 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3220141 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false stx1a-snap25-1 3220134 N/A 3220144 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3220145 unspecified role unspecified role prey prey Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220143 unspecified role unspecified role bait bait Region 1-261 Region 1-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false stx1a-snap25-2 3220135 N/A 3220144 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3220145 unspecified role unspecified role prey prey Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220142 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3220143 unspecified role unspecified role bait bait Region 1-261 Region 1-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false stx1a-stxbp3-1 3220136 N/A 3220140 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3220143 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false stx4-stxbp1-1 3220137 N/A 3220141 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3220142 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false stx4-stxbp1-2 3220138 N/A 3220141 unspecified role unspecified role unspecified role unspecified role Region 1-10 Region 1-10 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3220142 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false snap25-stx1a-19 3220139 N/A 3220144 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3220145 unspecified role unspecified role unspecified role unspecified role Region 1-94 Region 1-94 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3220143 unspecified role unspecified role unspecified role unspecified role Region 180-261 Region 180-261 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false