DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ klein-2011-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Klein BJ., Bose D., Baker KJ., Yusoff ZM., Zhang X., Murakami KS. DIP original experiment: DIP-249088X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA polymerase and transcription elongation factor Spt4/5 complex structure. Klein BJ., Bose D., Baker KJ., Yusoff ZM., Zhang X., Murakami KS. Only protein-protein interactions imex curation klein-2011-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Klein BJ., Bose D., Baker KJ., Yusoff ZM., Zhang X., Murakami KS. DIP original experiment: DIP-249089X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA polymerase and transcription elongation factor Spt4/5 complex structure. Klein BJ., Bose D., Baker KJ., Yusoff ZM., Zhang X., Murakami KS. Only protein-protein interactions imex curation klein-2011-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Klein BJ., Bose D., Baker KJ., Yusoff ZM., Zhang X., Murakami KS. DIP original experiment: DIP-249090X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA polymerase and transcription elongation factor Spt4/5 complex structure. Klein BJ., Bose D., Baker KJ., Yusoff ZM., Zhang X., Murakami KS. Only protein-protein interactions imex curation spt5_pyrfu Transcription elongation factor Spt5 spt5 PF1990 protein protein pyrfu Pyrococcus furiosus MAGKIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLISKLQKEE mint spt4_pyrfu Transcription elongation factor Spt4 spt4 PF0255 protein protein pyrfu Pyrococcus furiosus MSEKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKVPGKYAIRVR mint spt4-spt5-6 3220064 N/A 3220067 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3220068 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false spt4-spt5-7 3220065 N/A 3220067 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3220068 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false spt4-spt5-8 3220066 N/A 3220067 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3220068 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false