DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ akella-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. DIP original experiment: DIP-218304X Structure (London, England : 1993) 2010 IMEx The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. Only protein-protein interactions imex curation akella-2010-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. DIP original experiment: DIP-218305X Structure (London, England : 1993) 2010 IMEx The third conformation of p38α MAP kinase observed in phosphorylated p38α and in solution. Akella R., Min X., Wu Q., Gardner KH., Goldsmith EJ. Only protein-protein interactions imex curation pepmek3b MEK3b peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SKGKSKRKKDLRISCASK mk14_mouse Mitogen-activated protein kinase 14 Mapk14 Crk1 Csbp1 Csbp2 Mitogen-activated protein kinase p38 alpha CRK1 protein protein mouse Mus musculus Mouse MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES mapk14-pepmek3b-1 3218786 N/A 3218788 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3218789 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mapk14-pepmek3b-2 3218787 N/A 3218788 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3218789 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false