DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2010-52 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254408X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-53 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254405X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-54 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254401X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-55 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254404X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-56 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254403X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-57 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254407X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-58 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254406X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation chen-2010-59 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. DIP original experiment: DIP-254402X Nature 2010 IMEx Structure and control of the actin regulatory WAVE complex. Chen Z., Borek D., Padrick SB., Gomez TS., Metlagel Z., Ismail AM., Umetani J., Billadeau DD., Otwinowski Z., Rosen MK. Only protein-protein interactions imex curation nckp1_human Nck-associated protein 1 NCKAP1 HEM2 KIAA0587 NAP1 p125Nap1 Membrane-associated protein HEM-2 protein protein human Homo sapiens Human MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL mint cyfp1_human Cytoplasmic FMR1-interacting protein 1 Specifically Rac1-associated protein 1 p140sra-1 CYFIP1 KIAA0068 protein protein human Homo sapiens Human MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS abi2_human Abl interactor 2 Abelson interactor 2 Abl-binding protein 3 Arg-binding protein 1 ABI2 ARGBPIA protein protein human Homo sapiens Human MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE brk1_human Protein BRICK1 C3orf10 BRK1 HSPC300 MDS027 protein protein human Homo sapiens Human MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT wasf1_human Wiskott-Aldrich syndrome protein family member 1 WASF1 KIAA0269 SCAR1 WAVE1 Protein WAVE-1 Verprolin homology domain-containing protein 1 protein protein human Homo sapiens Human MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE wasf2_human Wiskott-Aldrich syndrome protein family member 2 WASF2 WAVE2 Protein WAVE-2 Verprolin homology domain-containing protein 2 protein protein human Homo sapiens Human MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD rac1-cyfip1-2 3218286 N/A 3218294 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3218295 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3218296 unspecified role unspecified role prey prey Q7L576:p.Cys179Arg C179R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q7L576:p.Arg190Asp R190D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q7L576:p.[Glu434Arg;Phe626Asp] E434R/F626D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q7L576:p.Met632Asp M632D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association false false false abi2-brk1-11 3218287 N/A 3218297 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218298 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3218299 unspecified role unspecified role unspecified role unspecified role Region 1-154 Region 1-154 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false abi2-brk1-12 3218288 N/A 3218294 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3218297 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218298 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3218299 unspecified role unspecified role unspecified role unspecified role Region 1-186/485-559 Region 1-186/485-559 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218296 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false abi2-brk1-13 3218289 N/A 3218294 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3218297 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218298 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3218299 unspecified role unspecified role unspecified role unspecified role Region 1-154 Region 1-154 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218296 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false abi2-brk1-14 3218290 N/A 3218294 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3218297 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218298 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3218299 unspecified role unspecified role unspecified role unspecified role Region 1-154 Region 1-154 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218296 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false wasf2-cyfip1-1 3218291 N/A 3218294 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3218300 unspecified role unspecified role bait bait Q9Y6W5:p.[Leu40Asp;Phe51Asp] L40D/F51D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9Y6W5:p.[Ile50Asp;Leu54Asp] I50D/L54D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3218296 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false abi2-brk1-15 3218292 N/A 3218294 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3218297 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218298 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3218299 unspecified role unspecified role unspecified role unspecified role Region 1-186/485-559 Region 1-186/485-559 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218296 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false cyfip1-nckap1-3 3218293 N/A 3218294 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3218296 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false